KEGG   Quercus suber (cork oak): 112017584Help
Entry
112017584         CDS       T05868                                 

Definition
(RefSeq) uncharacterized protein LOC112017584
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00900  Terpenoid backbone biosynthesis
qsu00909  Sesquiterpenoid and triterpenoid biosynthesis
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    112017584
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    112017584
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     112017584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 NmrA Polysacc_synt_2 adh_short RmlD_sub_bind KR HELP
Motif
Other DBs
NCBI-GeneID: 112017584
NCBI-ProteinID: XP_023905813
Position
Unknown
AA seq 339 aa AA seqDB search
MKKILVTGATGSLGGKLCHALFQQGHPVRVLVRRTSDLSSLPPPTDAAAIEIVYGDVTDY
QSLLAACSGCHVIFHVAAVVEPWLPDPSKFFSVNVGGLRNVLQAVRETKTIEKLIYTSSF
FALGPTDGGNVADENQVHHEKYFCTEYEKSKAIADKIAIQAASEGVPIVLVYPGVIYGTG
KVTSGNIVAKMIIERFNWRLPGYIGSGNDKFSFSHVDDVVEGHIAAMNKGRPGERYLLTG
ENASFRHVFDLAAIITETRKPMFNIPFWAIDAYGWASVLISRITGKIPLISPPAVKVLKH
QWAYSCEKAKVELDYNPRSLKDGLAEMLPWLKNLGLIKF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatactggtgaccggagcaactggttccttaggtggaaagctatgccacgcc
cttttccaacaaggccaccctgtccgagtgttggtccgacgcaccagcgacctctcctcc
ctccctccgcccactgacgccgccgccatagagatcgtctacggtgatgtcaccgactac
cagtccctcctcgctgcctgctctggctgccacgtcatcttccacgtggctgccgtcgtc
gagccctggcttcctgatccttctaaattcttctccgtgaatgttggaggattgaggaat
gtgttacaagcagtgagagagacaaagactattgaaaagcttatatacacgtcttcgttt
tttgcacttggaccaactgatggtggaaatgttgccgatgagaatcaagttcatcatgag
aagtatttctgtacggagtatgagaaatcgaaggcgattgctgataagattgccatacaa
gctgcatcagagggggttccgatagtgctggtttacccaggagttatttatgggactggc
aaggtcacttctggaaatattgttgccaaaatgattattgaacgctttaattggcgatta
cctggctatatagggtctggaaacgacaaattttcttttagccatgttgatgatgtagta
gaggggcatattgcagcaatgaacaaaggaagacctggtgaaagatatctactgacagga
gaaaatgcatcatttaggcatgtttttgatttagctgctatcatcactgagacaagaaaa
cctatgtttaatatcccattttgggcaattgatgcatatggatgggcctcagttttgatc
tcacgaattacaggaaagattcctctgatcagtcccccggcagtgaaagttctaaaacat
cagtgggcatattcctgtgagaaggctaaagtagagttggattataaccctagaagcttg
aaagatggcctagcagagatgctaccctggctgaagaatttgggcttgataaaattctaa

DBGET integrated database retrieval system