KEGG   Quercus suber (cork oak): 112019383Help
Entry
112019383         CDS       T05868                                 

Definition
(RefSeq) inactive receptor-like serine/threonine-protein kinase At2g40270
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    112019383
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112019383
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112019383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRRNT_2 LRR_8 LRR_4
Motif
Other DBs
NCBI-GeneID: 112019383
NCBI-ProteinID: XP_023907673
Position
Unknown
AA seq 640 aa AA seqDB search
MDQKWKPGHVVGVMVMCFFLSQNLCLSWCLNDEGLALLRLRERVVNDPFGALLNWKEEDG
VINPCSWFGVECSDGKVVVLNLKDLCLGGTLPTDLTKLVHIKSIVLRNNSFTGIIPEGIG
ELKELEVLDLGYNNFTGPLPAELGSNLSLTILLVDNNKLLGSLSPEIHELQLLSESQIDE
NQLSNVAKGLSCHERPLAWSISQSEDTFHRRLAQETKNSVDKPRATRVPSPSPSPSPSPS
PSPSPSLLIVPAPAPTDSSTSSPQPDVVPSSPENQKTSNHHRHRLSIVAGSIGGSLFLVI
LIIGVYLSKSNKVATVKPWATGLSGQLQKAFVTGVPKLKRSELETACEDFSNVIGSSPIG
TVYKGTLSSGVEIAVASVAATSAKGWSKSLETQFRKKIDTLSKVNHKNFVNLLGYCEEEE
PFTRIMVFEYAPNGTLFEHLHIKEAEHLDWGMRLRIAMGMAYCLEHMHQLNPLIAHNNLT
SSSICLTEDYAAKVSEFSFWNDMVVTEIESAGLKNLHTPSADPESNVYSFGVILFEMITG
KLPYSVENPSFEDWAADYLRGEQPFREMVDPTLTSFQEEQLELIGEVLKSCVHPNPKKRP
AMREVCTKLRAITGITPEGAYPRLSPLWWAELEIASADAS
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaaatggaaaccgggccatgtggttggtgtcatggtgatgtgcttctttttg
agtcagaatttgtgtttgagttggtgtctcaatgatgaaggtttggcgctgttgagatta
agggaaagagtagtgaatgacccatttggcgctttgttgaattggaaagaggaagatgga
gtgattaatccatgttcttggtttggggttgagtgctcagatggaaaagttgtggtcttg
aacttgaaagatctttgtcttggaggaacactgccaactgatcttacaaagctagtccat
ataaagtctattgttttgcgcaataattcttttaccggaattattcctgaaggaattggt
gagctgaaagaattggaggtgttagatttgggatacaataatttcaccggaccactccca
gctgaacttggcagtaatctttcactgacaatcctcctagtggacaataacaagcttctt
ggtagcttatctcctgagattcatgaactacagttgctttctgaatctcaaatagatgaa
aatcagctttccaatgtggctaaaggattatcttgtcatgaaagaccccttgcttggagt
atttcccaaagtgaagacacatttcacaggaggctggcgcaagaaacgaaaaactctgta
gataagcctcgtgcaacacgagtaccatccccatccccatccccatccccatccccatca
ccatcaccatcaccatcactattaattgtgcctgcccctgctccaactgattcctctaca
tcatctccccaacctgatgtagtgccttcttccccagaaaaccagaaaacttcaaatcat
catcgtcatcggttatcaatagtggctggatcaatagggggttccctctttcttgtaatt
ttaatcattggtgtatatctatctaaaagcaataaggttgctactgttaaaccttgggcc
acaggattaagcggacagcttcagaaagcatttgtaactggtgtgccaaagctcaagaga
tcagagcttgaaacagcttgtgaagatttcagtaatgtaattggttcttcaccaattggt
acagtttataaagggacactgtctagtggagtcgaaatagctgtggcctctgttgcagca
acatctgccaagggttggtcaaagagtttagaaacacagttcaggaagaagattgacaca
ttatcgaaagttaaccacaagaattttgtcaaccttcttggatattgtgaggaagaggag
cctttcaccagaatcatggtttttgaatatgctccaaatgggacactctttgagcattta
cacataaaagaggctgagcacttggactggggaatgcgtctgagaattgcaatgggaatg
gcttactgccttgagcatatgcaccagctgaacccacttatagcccacaacaacctgacc
tcttcatctatctgtctcactgaggattatgcagccaaggtatcagaattcagtttctgg
aatgacatggttgtaaccgagatagaatcagccgggttaaagaatttacatacaccatca
gctgatccagaaagcaatgtttacagctttggtgtgatattgtttgaaatgattaccggt
aagctcccttactcagtagagaatccctcatttgaagactgggcagcggactatttgaga
ggagagcaaccgtttagagaaatggttgatccaactttgacatcattccaagaggagcaa
ctagagctaattggtgaagtgctaaaatcttgtgtccatcctaaccctaaaaagagacca
gcaatgagagaagtgtgtacaaaattgagagccataactggaataacacctgaaggagca
tacccaagactttctccactttggtgggcagaactagagattgcatctgctgatgcaagc
tga

DBGET integrated database retrieval system