KEGG   Quercus suber (cork oak): 112020380Help
Entry
112020380         CDS       T05868                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    112020380
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112020380
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112020380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal YukC APH PIP49_C
Motif
Other DBs
NCBI-GeneID: 112020380
NCBI-ProteinID: XP_023908713
Position
Unknown
AA seq 296 aa AA seqDB search
MFKGKLSNEIHVTLKILNSSKGNREEFINEVGTMGRIHHVNVVHLVGYCTDGFRRALVCE
FLPNDSLEKFISSIDSNSFLGWEKLLDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLD
QNFNPKISDFGLAKLCAKDQSAVSMTTARGTIGYIAPKVFSRNFGNVSYKSYVYSFGILL
LEMVGGRKNVGVIVENTSQIYFLEWMYNLLEEKEDLRVYVEDNVDAKIAMKLAIVGIWCI
QWHPMDRHSKKVVVQMLEGDGDNLTMPPNPFASTGPTRINASTPARRLNLDLDFIP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaggaaagctttcaaatgaaatccatgttaccttgaagatcttgaacagttcc
aagggcaacagggaagaattcataaatgaagtgggaacaatgggtagaatccaccatgtt
aatgtggttcatttggttggctactgcactgatggatttagaagggcattagtttgtgag
ttcttaccaaatgattcactagagaagtttatttcgtccatagattctaatagtttcctt
ggttgggaaaaactactagacattgctcttggcatagcaaaaggaattgaatatcttcac
caaggatgtgatcaacgaattctccattttgatatcaaacctcataatattttgctagac
caaaatttcaatccaaaaatttctgattttggtctagccaagttgtgtgcaaaggatcaa
agtgcagtgtccatgaccacagctagggggaccataggttacattgctcccaaagtgttc
tctaggaactttgggaatgtgtcttacaaatcatatgtttacagttttggaatattgttg
cttgagatggttggaggcaggaaaaatgttggtgtaatcgtggagaacactagccaaata
tattttctagaatggatgtacaatctattagaggaaaaggaagacttacgagtctatgtt
gaggataatgtagatgctaaaattgcaatgaaactggcaattgtggggatatggtgcatc
caatggcacccaatggatcgtcattcgaagaaagttgtggttcaaatgttggagggtgat
ggagataacttaacaatgcctccaaatccctttgcctctacaggccctacaagaatcaat
gcaagtacgcctgcaaggcgtctaaatctagatttagacttcatcccttag

DBGET integrated database retrieval system