KEGG   Quercus suber (cork oak): 112022268Help
Entry
112022268         CDS       T05868                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112022268
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:qsu03041]
    112022268
Enzymes [BR:qsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     112022268
Spliceosome [BR:qsu03041]
 Complex C
  Other components
   Step II factors
    112022268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD AAA_22 AAA_30 ABC_tran AAA_19 cobW DUF2075 T2SSE MMR_HSR1 AAA_16 AAA_29 Helicase_RecD Sigma54_activ_2 AAA_23 AAA_14 ATPase_2 DAP3 AAA_33 Sigma54_activat SRP54
Motif
Other DBs
NCBI-GeneID: 112022268
NCBI-ProteinID: XP_023910604
Position
Unknown
AA seq 700 aa AA seqDB search
MANLPILQFEEQIVETVDRNPVVVIIGETGSGKSTQLSQILHRRGYTKSGIIGVTQPRRV
AAVSVARRVAQELGVHLGDEVGYAIRFEDRTSERTHIKYLTDGVLLRESLSNPELSQYSV
IILDEAHERSLNTDILLGLMKRLVRMRASNLKVLITSATLDGEKVSNFFSNCPILSVPGK
LYPVEILYSNERPTSYLEASLKTALDIHIREPEGDVLIFMTGQDDIEKLVSKLEDRVQSL
QEGSCLDAIILPLHGSLPPEMQVRVFSPPPPNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSTGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSILYNDDFLDVTVPE
IQRSSLAGSVLYLKSLDLSDMDILKFEFLDPPSSESLEDALKQLYLIDAIDENGLITSIG
RVMAELPLEPSLSRTLMEANECGCLFQALTVAAMLSAETTLLPGRSKSTEKKRKHTHSDL
PDGSGWGDHIQLLQIFEEWDRTNYDIGWCKGHNLQVRGMLFVKDVRKQLSQIMQKIAKGS
LDVWANGRWKEGEQDYRNLRKALCIGFANQLAERMVHHNGYRTLGFKPQVVQVHPSSVLK
PDDEGKLPEYVVYHELIATSRPYLRNVCAVEIHWVMPILNKVKKINVNKLSGGTDLTVEG
TEGKLSDLPKKEVNIAGVPDDHESRIQAARDRFLARKAKK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccttccgatcctccaattcgaggagcaaatcgtagaaacagtggaccggaac
ccggtggtggtgattatcggagagaccggttcgggaaagagcacccagctctctcagatt
ctgcaccgcagaggctacaccaagtctggaatcatcggcgtcactcagcctcgccgagtc
gctgcagtctcagtcgccagacgggttgctcaggaacttggggttcatcttggggatgaa
gtgggatatgccatccgatttgaagacagaacctcagaaaggactcatattaaatatcta
actgatggagtcctccttcgagaaagtctgtccaacccagagcttagccagtattcagta
atcatattggatgaagctcatgagaggagtctgaacacggacatattgctgggactaatg
aaacgcttggttagaatgcgtgcctccaatttaaaggttcttatcacttcggcaactctt
gatggtgaaaaagtatcgaattttttctcaaattgccccatactaagtgtcccagggaag
ttataccctgtagaaatattgtacagcaatgagcgccctaccagctatcttgaagcatct
ttgaaaacagctcttgacatacacattcgagaaccagaaggtgatgtcctaatattcatg
actggacaggatgatatagagaagttggtatcaaagttggaggatagagttcaaagtctt
caggaaggatcttgtttggatgccataatccttccccttcatggttctttgccacctgaa
atgcaggtgcgtgtatttagtcctccacctccgaattgccggcgatttattgttgccaca
aatattgctgaaacttcattgacagttgatggtgtcgtgtatgttattgattctggttat
gtcaagcaacggcaatacaacccatcaaccggcatgtattcccttgatgttgttcaaatt
agcaaagtgcaagctaatcagcgggcaggtcgagctggaagaacacgtcctgggaagtgc
tatcggttatacccttccatactttataatgatgacttcctagatgtaacagttcctgaa
atacagagatcttctcttgctggaagtgttctttatttgaaatcattggacctctctgat
atggatattctcaagtttgagtttcttgatcccccttcctctgagtctttagaagacgct
ttgaagcaattatatctcattgatgcgattgatgaaaatgggttgatcacaagtattgga
cgagtaatggctgagcttccactagaaccttcactctcaagaaccttaatggaggcaaat
gagtgtggttgcttattccaggctttgactgttgctgccatgttatcagcagaaactaca
ttgcttcctggtcgaagcaagagtactgagaaaaagaggaaacacactcactcggacctt
cctgatggatctggttggggtgatcacatccaattgcttcagatttttgaggaatgggat
agaactaactatgatattggttggtgcaaaggccataacttgcaggtgcgggggatgttg
tttgtcaaagatgtccggaaacaattatctcagataatgcagaaaatagcaaagggatca
ctagatgtttgggctaatggaagatggaaagagggtgagcaagattaccgtaatttgagg
aaggcgttgtgcataggttttgcaaatcagcttgctgagagaatggttcatcacaatggc
tatcgaactctaggtttcaagccccaagtagttcaggtgcacccatcctctgtgctgaaa
ccagatgacgagggaaagcttccagagtatgttgtctaccatgagctcattgcaacctca
cgcccatacttacgtaatgtatgtgctgtagaaattcattgggtcatgcccattttaaac
aaggttaagaagataaatgtcaacaaactgagtggtggaactgatcttacagtagaagga
actgagggaaaactctcagacttgccaaagaaagaggttaacattgctggggttcctgat
gaccacgaaagtagaattcaggcagctagggatcgatttcttgctcgcaaagcaaagaaa
tga

DBGET integrated database retrieval system