KEGG   Quercus suber (cork oak): 112024058Help
Entry
112024058         CDS       T05868                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00450  Selenocompound metabolism
qsu00970  Aminoacyl-tRNA biosynthesis
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    112024058
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    112024058
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:qsu01007]
    112024058
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:qsu03016]
    112024058
Enzymes [BR:qsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     112024058
Amino acid related enzymes [BR:qsu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   112024058
Transfer RNA biogenesis [BR:qsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    112024058
 Prokaryotic type
   Other AARSs
    112024058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 112024058
NCBI-ProteinID: XP_023912461
Position
Unknown
AA seq 82 aa AA seqDB search
MAAKVPIKGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNALYICGTDE
YGTATETKALEENSTPKQICDK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaggttccgattaagggtaaacggaacatcctcatcaccagcgccttgcct
tatgtcaacaacgtcccccatcttggaaacatcatcggttgtgtgctgagtgctgatgtg
tttgctcgctattgccgactccgaggctacaatgccttgtacatatgtggaactgatgag
tacgggacggccactgagactaaagctctggaagagaactccacccctaagcagatttgc
gacaagtaa

DBGET integrated database retrieval system