KEGG   Quercus suber (cork oak): 112024632Help
Entry
112024632         CDS       T05868                                 

Definition
(RefSeq) heat shock 70 kDa protein 3-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu03040  Spliceosome
qsu04141  Protein processing in endoplasmic reticulum
qsu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112024632
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112024632
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112024632
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:qsu01009]
    112024632
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:qsu03041]
    112024632
   03009 Ribosome biogenesis [BR:qsu03009]
    112024632
   03110 Chaperones and folding catalysts [BR:qsu03110]
    112024632
   04131 Membrane trafficking [BR:qsu04131]
    112024632
   03051 Proteasome [BR:qsu03051]
    112024632
   03029 Mitochondrial biogenesis [BR:qsu03029]
    112024632
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:qsu04147]
    112024632
Protein phosphatases and associated proteins [BR:qsu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112024632
Spliceosome [BR:qsu03041]
 Complex B
  Other components
   Prp19 complex
    112024632
 Complex C
   Prp19-CDC5 complex
    112024632
Ribosome biogenesis [BR:qsu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112024632
Chaperones and folding catalysts [BR:qsu03110]
 Heat shock proteins
  HSP70 / DNAK
   112024632
Membrane trafficking [BR:qsu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112024632
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112024632
Proteasome [BR:qsu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112024632
Mitochondrial biogenesis [BR:qsu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112024632
Exosome [BR:qsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   112024632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl ABC2_membrane
Motif
Other DBs
NCBI-GeneID: 112024632
NCBI-ProteinID: XP_023913013
Position
Unknown
AA seq 463 aa AA seqDB search
MREEETLCNYASRYWEFYNEIGRGNEKIATSTFRMGLPEESGLRESLTKKPPEDMRQLMR
RIEEYKRLEDDRMQSKGGCLCRGNDEGNDEGVKRAVVTVPASFTDSQHQASKNAGVLAGL
DVIRIISEPTVASIAYNFKETSIVGKNVLIFDLGGGTFDVSLLTIRKGKLEMKATAGDAH
LGGEDFVNRMLNHFVDKFKKENKRDFSGIPKALSKLRTACRKARDTLSSAIDATIDFKYD
GVNFQKKISRDTFEEINIDLFKKCVVLVEQCLRDAKMDDSTIHDIVLVGGSTRIPKVKKL
LLSFLNVKEFRGSVNREGAVAYGAAYQAYILTHNKKVLDLVLSDVIPRSLKLKSTASGDG
LMLSLLLQALLPAPPYHHFHHHFSGKITGKFLGTCLCPFTLDDVFFLAVHGGKRNNQQNL
SNVFGSMYAAVIFLGINNCSTVLPYVATEPTIMYQEIFAGMAL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagaggaaaccctttgtaattatgctagccgatattgggagttttacaatgag
atcggcagaggaaacgagaagattgccacaagcacatttaggatgggattgcccgaggag
tccgggctgagggaatcattgactaagaagcctcccgaagacatgaggcagctaatgagg
cgcattgaagaatataaacggctggaagatgaccggatgcaaagcaaaggagggtgcttg
tgccgaggaaatgatgaaggtaatgatgaaggagtaaagagagcggttgtgaccgttcca
gcttcctttaccgactctcagcaccaggcaagtaagaatgctggggtccttgctggtctc
gatgtgatacgtatcatcagtgagcccactgttgcatccattgcttataattttaaagaa
accagtattgttggcaagaatgttttgatttttgatcttggtggtggcacttttgatgtc
tcacttcttacaattagaaagggaaagttagaaatgaaggccacagctggtgatgctcac
cttggaggggaagactttgttaatagaatgctgaaccactttgttgacaagtttaagaag
gagaataagagagattttagtgggatccccaaagcccttagtaagttgaggactgcttgt
aggaaggcgagggatacactatcatccgctatagatgccaccattgactttaagtatgac
ggtgttaacttccaaaaaaagattagtcgtgatacgtttgaggagatcaatattgatctc
tttaaaaagtgtgtggtactcgttgagcagtgtttgagggatgctaagatggacgacagc
actatccatgatattgtccttgttggaggttctactaggattcccaaggtgaagaagctg
ttgctgagcttcctcaatgtgaaggagtttcgtggaagcgtcaatcgagaaggtgctgtt
gcttatggtgctgcttatcaggcttatatcttgacacataacaagaaagttctggatctg
gtgttatcggatgtcatccctcggtcacttaaattgaagagtactgccagtggtgatggg
ctgatgctctctttactccttcaagctctcttgccggcacctccatatcaccatttccac
catcatttttccggcaagatcaccggaaaatttttgggaacctgtttgtgccctttcact
ttggatgacgtgttcttccttgctgtccatggggggaagaggaataaccagcagaatttg
tccaatgtatttggttccatgtatgctgcagtgatcttcttgggcataaataactgctca
acagttctaccatatgttgcaacagagccaactatcatgtatcaggaaatatttgcaggg
atggcattatga

DBGET integrated database retrieval system