KEGG   Quercus suber (cork oak): 112025457Help
Entry
112025457         CDS       T05868                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like
  KO
K20538  mitogen-activated protein kinase 8 [EC:2.7.11.24]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    112025457
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    112025457
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112025457
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112025457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Herpes_UL42
Motif
Other DBs
NCBI-GeneID: 112025457
NCBI-ProteinID: XP_023913897
Position
Unknown
AA seq 224 aa AA seqDB search
MSGLVRWFQRLSSFSSSSTSSSAVDDHDHDDYHSQNDAVQTQSESQKELTITVDLDISGL
KPIKVPDRTAHKLAPTDPHKSMLDKEFFTEYGEASQYEIQEVVGKGSYGVVASAIDTHTG
ERVAIKKINDVFEHVSDATRILREVKLLRLLRHPDIVEIKHIMLPPSRREFQDIYVVFEL
MESDLHQVIKANDDLTPAHFQFFLYQLLRALKYIHTGWPPFSLF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcttggttcgctggtttcaacgcctctcttctttttcttcttcatccacatcc
tcctctgccgttgatgatcacgatcatgatgattatcactcccaaaacgacgccgtacaa
acacagagtgaaagtcaaaaggagctgacgatcactgtggacttagatatctcaggtttg
aagccgatcaaggtccccgatcggaccgctcacaagctcgcccccaccgatcctcacaag
agcatgcttgacaaagaatttttcacagaatatggtgaggcaagtcaatatgaaattcaa
gaagtagttggcaaaggaagctatggtgtcgttgcctctgcaattgatactcacactgga
gagagagtagctataaagaaaatcaatgatgtctttgagcatgtttctgatgcaacacgt
attctgagagaagtcaagcttcttaggctgcttcgacacccggatattgtagaaataaaa
catataatgcttcctccttctagaagagaatttcaagatatttatgtcgtgtttgagttg
atggaatctgaccttcaccaagtaattaaggcaaatgacgatcttacacctgcacatttt
caatttttcttataccagcttcttcgagctttaaagtatatacatacaggttggcctcca
ttttcattgttctaa

DBGET integrated database retrieval system