KEGG   Quercus suber (cork oak): 112026144Help
Entry
112026144         CDS       T05868                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 6
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00520  Amino sugar and nucleotide sugar metabolism
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    112026144
Enzymes [BR:qsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     112026144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-GeneID: 112026144
NCBI-ProteinID: XP_023914595
Position
Unknown
AA seq 347 aa AA seqDB search
MASKNSSNGDHQTTTKPPPLPSPLRFSKFFQSNMRILVTGGAGFIGSHLVDRLMENEKNE
VIVADNYFTGSKDNLKKWIGHPRFELIRHDVTEPLLVEVDQIYHLACPASPIFYKYNPVK
TIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQPESYWGNVNPIGVRSCYDEG
KRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRGEPLTVQLPGT
QTRSFCYVSDMVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPEVEIKKVENT
PDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRQRLGVAKKN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcatctaagaacagttcaaacggggatcaccaaacaacaactaagccaccaccattg
ccgtctccattgcgattttcaaagttctttcagtcaaatatgagaattttggtcactgga
ggagctggattcattggctctcacctagtcgatagattgatggaaaatgaaaaaaatgag
gtaattgttgctgataactacttcactggatcaaaggacaatcttaaaaaatggattggt
catccaagatttgagcttattcgtcatgatgtcactgagccgttgttggtcgaggttgat
cagatttatcatcttgcttgccctgcttctccaattttctacaaatacaatcctgtgaag
acaataaaaacaaatgtgattggtacactaaacatgctgggacttgccaagcgagttgga
gccaggattttgcttacatcaacttcagaggtatatggagatcctcttgtgcatccccag
ccagagagctattggggaaatgtgaacccaattggagttcggagctgctatgatgaagga
aagcgcgtggctgagactttgatgtttgattatcataggcagcatgggatagaaattcgc
attgccagaatctttaacacatatgggccacgcatgaatattgacgatgggcgtgttgtc
agcaatttcatagctcaagcacttcgtggtgaacccttgacagtccaacttcccggaaca
caaactcgcagtttctgttatgtttctgacatggtcgatggcctcattcgtctgatggaa
ggagagaacactgggccaatcaatattggaaacccaggtgaatttacaatgcttgaactt
gcagagacagtgaaggagcttatcaatcctgaggtggagataaagaaggtggagaacact
cctgatgatccacgacaaaggaaacctgacatcacgaaagctaaagaattgctgggatgg
gagccaaaagtcaagttgagagatggccttcccctcatggaggaagatttccgacagagg
cttggtgtggccaaaaagaactga

DBGET integrated database retrieval system