KEGG   Quercus suber (cork oak): 112026527Help
Entry
112026527         CDS       T05868                                 

Definition
(RefSeq) wall-associated receptor kinase 2-like
Organism
qsu  Quercus suber (cork oak)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase GUB_WAK_bind EGF_CA cEGF EGF_3 WAK PIP49_C Oxidored_molyb APH
Motif
Other DBs
NCBI-GeneID: 112026527
NCBI-ProteinID: XP_023914984
Position
Unknown
AA seq 737 aa AA seqDB search
MLFWENSGAMGFHSMLVLVTWVGVMLTAIMAAAAIAYPLALPNCSDSCGDVNIPYPFGTT
EGCYRKEESRHFLINCSESSGHPQPTLWNIDVTRISIEGEMDVMMDSSINCYDQSGTPLP
TNNELGLQVPSFTVSVTKNKFVAVGCDTYTFLNGTLKDAPFTTGCQSICNDKRQIVNGSC
SGIGCCHIDIPEGLTKVRFAAYSYKSHKDVWSFNPCSFAFFIQEDKFSFSLAYLTSLQNN
RTFPMVLDWAIGNETCEVARNKGNYICGANSNCSDLKNGSGYRCKCKKGYDGNPYLKDGC
QDIDECNEKKICPVKQNCVNEVGSYRCSCINGYRKVEEVCVPSLTIYLAVGIGIVSLLVL
LLGCSWIYWGLKKRKFIKLKEKFFQQNGGLLLKQQLSNHQNSIETTKIFTTEELKKATNN
YDESRVLGQEGYGTVYRGVLLDNTVVAIKKSKIGDQSQIEQFINEMIVLTQINHRNVVKL
FGCCLETEVPLLVYEFITNGTLANHVHDKSLSSLLSWEKRLKIATEIAGALAYLHSSTSM
SIIHRDVKIENMRLDNDYIAKVADFGASRLVPLDQTQLNTLVQGTWWYLDPEYIQTSQLT
EKSDVYSFGVVMAELLTGKKALSFDRPENDRNLAISFVSAIKEDSLLQILEDHIVSESNI
EQLNEIANLAKRCLSLRGEDRPFMKEVANELERLRSMEKTPLGNFDVDGKKTEYLLSATS
HSFNIDVGIGCSTSTNC
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgctcttctgggaaaatagtggggctatgggtttccattcgatgcttgtgctagtcacc
tgggttggtgtgatgttaacagcaataatggcagccgcagcaatagcatatccattagcc
ttgcctaactgctccgacagctgtggggatgtaaacattccatatccctttggcacaact
gaaggttgttaccggaaagaagaaagtagacactttttaatcaactgtagcgaatcgtcc
ggccatcctcaaccaacgctctggaacatcgacgttacaagaatttccatcgaaggagag
atggacgtcatgatggatagctccattaactgttacgaccagtcgggtacgcctctgcca
actaacaatgaactagggctccaggtccccagtttcacggtttctgtcaccaaaaacaag
ttcgtggcagttggctgtgacacttacacattccttaatggtactctcaaagatgcaccg
tttaccaccggctgccagtctatatgtaacgacaaacgccaaattgtaaatgggagttgc
tctgggattgggtgttgccatatagatattcctgaaggtttgacaaaagttagatttgca
gcatatagctataagagccacaaagatgtctggtctttcaacccatgcagctttgccttt
tttatccaggaagacaagttcagtttctccttagcttatctaaccagtctacaaaacaat
agaacctttcctatggttcttgattgggcaattggtaacgagacgtgtgaagttgctcgg
aacaaagggaattacatatgtggagcaaatagcaattgttctgatctaaaaaatggttct
gggtaccgttgcaagtgcaagaaaggttacgatgggaacccatacctcaaagatggttgc
caagacattgacgaatgcaacgagaaaaaaatatgccctgtaaaacaaaattgtgtcaat
gaagtcgggagttatcgttgttcgtgcatcaatggataccgtaaggttgaagaagtatgt
gttccatcgctaacaatttacctcgcggttggtatcggcatagtcagcctcttagtactg
cttctgggatgttcttggatatattggggattgaaaaaaagaaagttcatcaaacttaaa
gaaaaattcttccaacaaaatggtggcttattgttaaaacaacaactctctaatcaccaa
aattctattgagacaaccaaaatctttactacagaagagctcaaaaaggccaccaacaac
tatgacgagagtagagtccttggccaagaaggctatggaactgtgtatagaggagtatta
ttagataacacagtagttgccattaagaagtccaaaattggtgatcaaagccaaatcgag
caattcataaatgaaatgattgttcttacccaaattaaccataggaatgtggttaagcta
tttggttgttgtctagaaacagaagttcccttactagtttatgaattcatcacaaatggg
actcttgccaatcacgttcatgataaaagtctatcatccttactttcatgggagaaacgc
ttgaaaattgcaacagaaattgcaggagcacttgcatacttgcattcatcaacttctatg
tcaattatacacagagatgtgaaaattgaaaatatgcggttggataatgattatatagca
aaagtggctgactttggagcttcaaggctagttcctcttgatcaaacacaattgaacact
ttggtgcaaggaacttggtggtacttggacccagaatacatacaaactagccaactaaca
gaaaaaagtgatgtatatagctttggtgttgttatggcagagttgttaacaggtaagaag
gcactttcttttgataggccagaaaatgatagaaatctagcaatatcttttgtttctgct
ataaaagaggatagcctacttcaaattcttgaagatcacattgtcagtgagagtaatatt
gagcaactaaacgaaattgctaatcttgcaaaaaggtgcctaagtttgagaggggaggat
agacctttcatgaaagaagtggcaaacgagctggagagattgagaagtatggaaaaaact
ccattgggaaactttgatgtcgatggaaaaaagactgagtacttgcttagtgcaactagt
cactctttcaacatagatgttggcattggttgttctacgagtaccaactgctga

DBGET integrated database retrieval system