KEGG   Quercus suber (cork oak): 112026581Help
Entry
112026581         CDS       T05868                                 

Definition
(RefSeq) receptor-like protein kinase FERONIA
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    112026581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 112026581
NCBI-ProteinID: XP_023915039
Position
Unknown
AA seq 349 aa AA seqDB search
MTEASMEAISQYFSKLLRTSGKRAKQSLLLPEGLCRRFSLAEIKIATNNFDDDSVIGEAA
FGKIYKGFICDCTVSVAIKRRNWMLGQGVKEFGTELVLLGQLRHPNLVNLIGYCTDEQEM
ILVYEFIVGGSLDRHLLHQDQHDPLPWKRRLQICIGVARGLHYLHTGVKHTIIYRDVKLT
NILLGENWKAKLAGFGLCKKGPPSLSKALIRIDSEVKGTVGYLDPAYLRTSQLTDKTDVY
CFGVVLFEVLCARRSVDMESEREQSMAVWAPACVEDGTINQIIDPYLIGRIAPECFKIYV
NIGTSCLREDDMERPSIGEVEVGLEHALELQECADAAMRKDDVDAGSDQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcgtcaatggaagctatttcgcagtatttttcaaagttattaaggacgtcc
gggaagagagcaaaacaatctttacttcttccagagggattatgccggagattttcactc
gctgagatcaagatagctaccaataacttcgatgatgattcagtaattggtgaggcagct
tttggcaaaatatataagggatttatttgtgactgtaccgtaagcgttgcaataaagcgt
cgtaattggatgttaggacagggtgtcaaagagtttgggacggagttagtgttgcttggc
cagctacgccacccgaacctcgtcaatctcatcggatattgtactgacgaacaagagatg
atcctagtttatgagttcatagtaggtggatccctcgacagacacctcctccaccaggac
caacatgatccccttccgtggaaacgaagactacagatttgcattggagtggcgcgtgga
ctgcactaccttcacactggagttaagcatactataatctaccgcgacgtgaagttgaca
aacattttattgggtgagaactggaaggccaagctggcaggtttcggcttgtgcaagaag
ggtcccccgagtttgtcaaaggctttaattaggattgattctgaagtgaagggtactgtt
ggatacctggatcccgcttatcttcgaacgagtcagctgaccgataaaactgacgtctac
tgtttcggtgtggtactgtttgaagtgctctgtgcgagaagatcagtggacatggaatca
gagagagaacagagtatggccgtctgggctccagcatgcgtagaagatggcaccattaat
cagattattgatccctatctgatagggaggatagctccagagtgtttcaagatatacgtg
aacattggaacttcttgcctgcgagaagacgatatggaacgtccctcgattggtgaagtg
gaggtaggccttgaacacgcactggagctgcaagagtgtgcagatgctgcgatgaggaag
gatgatgtggatgctggtagtgatcaatga

DBGET integrated database retrieval system