KEGG   Quercus suber (cork oak): 112026680Help
Entry
112026680         CDS       T05868                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00010  Glycolysis / Gluconeogenesis
qsu00562  Inositol phosphate metabolism
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112026680
   00562 Inositol phosphate metabolism
    112026680
Enzymes [BR:qsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     112026680
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     112026680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4398 DUF4164
Motif
Other DBs
NCBI-GeneID: 112026680
NCBI-ProteinID: XP_023915137
Position
Unknown
AA seq 497 aa AA seqDB search
MKRAIHFVLLLFLSLLLYSYAEEAFDVRQHLSTVTRYGAVKGIADNSIIASNIPDGCTPI
HINLVARHGTRSPTKKRIKELDNLEARLEVLLRDAEERKLSLQKVPSWIQGWKSPWKGKL
KGGELISKGEEELYALGIRIREKFPDLFNEEYHPDVYTIRATQVPRASASAVAFGMGLFI
GTGSLGPGRHRAFAVTGESRASDLLLRFYESCENYKDFRKKQEPAVGKDKEPILDKITSS
LVSRYMLNFTRQDTSSLWFLCKQEASLLDITDQACSLFTPSEVREISLLEWTDDLELFIL
KGYGNSLNYKMGVPLLQDVLQAMEQAIKAQEEKHAPGSYEKARLRFAHAETVVPFSCLLG
LFQEGSGFQQIQEEKSLERPPKPPQQRNWRGSVVAPFAGNNMLVLYSCQANSSSKYFVQV
LHNEDPIPLPGCDSDFCPFELFKENIVYPHLKSNYNQVCMVKRETPEQKPSMASKLSQLF
QFFSLGNDGKQTHEDEL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagagggcaattcattttgttctgctactgtttttatctctgttgctttattcttat
gctgaagaagctttcgatgtgcgccaacacttgtctaccgtcaccagatacggtgctgtg
aaaggaattgctgataattccattatagcttccaatattcccgacgggtgtactcctatc
cacataaatcttgtggcaaggcatggaactcgctctcccactaagaaacggataaaagag
ttggacaatttggaagctcgtttggaagtacttctaagagatgcagaagaacggaaattg
tctttacaaaaagttccttcctggatacaaggatggaaatctccttggaaaggaaagctg
aagggtggagaactaattagcaagggagaggaagaattgtatgctcttggaatcaggatt
agagaaaaattcccagatctttttaatgaggagtatcaccctgatgtttatacaataagg
gcaactcaggttcctcgggcatcagctagtgcggtggcatttggaatggggctttttatc
gggacaggaagtcttggaccaggacgtcatcgagcttttgctgttactggtgaaagccgt
gcaagtgatttattgctaaggttttatgaatcttgtgaaaactacaaggatttcaggaaa
aagcaggagcctgctgttggtaaggataaggagcctattcttgataaaattacctcttca
ttagtgagtcgttacatgctgaattttacgaggcaagatacttcttctctctggttttta
tgcaaacaggaagcatctttgttggacataactgatcaagcttgtagtcttttcacccct
tctgaggtacgtgagatttctttgttggagtggacagacgacctggagctgtttatattg
aagggttatggtaattcattaaactataaaatgggagtgccattacttcaagatgtttta
caagccatggaacaagctatcaaggctcaagaagaaaaacatgctcctggaagttatgaa
aaggcacgacttcggtttgcacatgcagaaactgttgttcccttctcatgtcttcttgga
ctttttcaagaaggatctggatttcaacaaatacaagaagaaaaatccttggaacgacct
ccaaagccaccccaacagagaaattggaggggcagcgttgtcgctccttttgctgggaat
aacatgctggttctgtacagctgtcaagctaactcttcaagcaagtactttgtgcaagta
ctgcacaatgaagatcccattccattgccaggttgtgacagtgatttctgtccatttgaa
ctttttaaggaaaacatagtttatcctcatctaaagtccaattataatcaagtctgcatg
gtaaagcgggaaacaccagagcagaaaccttctatggccagtaagttatcacagcttttc
cagttcttctcgttggggaatgatggtaaacagactcacgaagatgaattatag

DBGET integrated database retrieval system