KEGG   Quercus suber (cork oak): 112031062Help
Entry
112031062         CDS       T05868                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
Organism
qsu  Quercus suber (cork oak)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Lectin_legB Kinase-like PIP49_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 112031062
NCBI-ProteinID: XP_023919509
Position
Unknown
AA seq 623 aa AA seqDB search
MSLTRLRHYFIGPCIVLFISSPFLHSFASPLSFKITDFSHNDASKITYEGDAAVSDRAIK
FYLDDSDPSNGTIVYAESMHLWDCSTRSQANFGTNFSFTIDSVDASASLSFFLAPVHPAY
PPNLTARGEIVVVEFEINPNSNVGININGETYCSESYARRDANLTGNVLITYNAKTKTLN
ASYIKERSYLSCSNIIDLKAALPKWVTIGFFAAGSSKHKWHSWEFHSNFESMALCYNKKR
TIVVVSVVVCFLILMLVVGVISWLLAGVKRKRYKNDSRGGDIDSVSSISTDLERGALPKK
FSYSDLVAATEGFADDRRLGQGGSGQVYRGTLGDLDRPVAVKRIFTESQHSQCLFINEVK
IISRLIHRNLVQFIGWCHERGEFLLVYEHMSNGSLDNHLFGDGEILPWNSRYKIALGLAS
ALHYLHEEAENCVLHRDIKSANILLDADFSTKLGDFGVAKLVDPRLRTQSTGVVGTYGYL
APEYANEGKASKASDVFSFGVVALEIACGRRTYQDGEFHVSLVRWIWQLYLAGDILNAAD
ERLRMSFNRDEMKRLLIVGLWCTNPNYKERPKTGQVMKVLLLESPLPELSDDMHDSLLQP
IPPPQEGHSFQPSMTSSLNYGGR
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaaccagacttcgtcactatttcattggtccctgcattgttctcttcatttcc
tctccctttctacattcctttgctagtccactttccttcaagataactgattttagtcat
aacgatgcttcaaaaattacctatgaaggtgatgctgctgtttccgaccgagcaattaaa
ttctacttggatgattctgatccatcaaacggaaccattgtctatgcagagagcatgcac
ctttgggactgctcaacaaggtctcaggcaaacttcggcaccaatttctctttcaccatt
gacagtgttgatgccagtgccagcctttcctttttcctggctcctgttcacccggcatat
ccacccaacttgactgcacgtggagaaatcgtggtggttgagttcgaaattaatccaaat
tcaaacgttggaattaatatcaatggagagacatactgttcagaaagctatgcacgtagg
gatgctaacttgactgggaatgttctgattacttacaatgctaaaaccaagacccttaat
gcgtcctatattaaagagaggtcttatctttcttgcagcaatattattgatctaaaagca
gctcttcccaaatgggttacaattggtttctttgctgccggcagctcaaagcataagtgg
cattcatgggaatttcactcaaattttgagtccatggcgctatgctacaataaaaagagg
acaattgtggtcgtgtctgttgtagtgtgtttcttgattttgatgcttgtagtgggcgtc
atcagttggttattagcaggtgtgaagaggaagagatataagaatgatagccgtggaggt
gacatagattcagtctcctccataagtacagatcttgagagaggagcgttgcctaaaaaa
ttttcttactcggacttagttgcagccacagagggttttgcagatgatagaaggctaggt
caaggaggttctggccaagtctacagaggaaccttgggtgacttagaccgccctgttgct
gtaaagagaatcttcacggaatcacaacactctcagtgtctattcatcaacgaagtaaag
ataataagccgtttaatacatcgaaacctggtacagttcattgggtggtgtcatgagcga
ggcgaattcttacttgtttatgagcacatgtcaaatggtagccttgacaatcatctcttt
ggtgatggagaaatcttgccatggaattcgagatacaagattgctttgggcttggcctcg
gcccttcattatctccatgaagaagcagagaactgtgtacttcatagagacatcaagtca
gctaatatattactagacgcagatttcagtactaaacttggtgattttggggttgccaag
ttggtagatcctcggttgaggactcaaagtactggtgttgtagggacttatggctacttg
gccccggaatatgctaatgaagggaaggcgagtaaagcttcagacgtatttagttttggt
gtagtggctctggaaatcgcatgcgggaggaggacttaccaagatggggaatttcatgtg
tcactggtgaggtggatttggcagctctatcttgcaggagatattctaaatgcagctgat
gagagattgcgcatgagttttaacagggatgaaatgaaacgcttgttaattgtgggattg
tggtgtactaatccaaactacaaggaaaggccaaagacaggacaagtaatgaaggttctt
ctgcttgaatcaccactgccagagctttcagatgacatgcatgattccctgctgcagcca
atccctccaccccaagaaggtcattcctttcaaccatcaatgacctcaagcctcaactat
gggggtcggtaa

DBGET integrated database retrieval system