KEGG   Quercus suber (cork oak): 112031190Help
Entry
112031190         CDS       T05868                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.2 isoform X1
Organism
qsu  Quercus suber (cork oak)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 112031190
NCBI-ProteinID: XP_023919646
Position
Unknown
AA seq 701 aa AA seqDB search
MKIFTLSKMGRELPFTAGLTALTVFVLVHKTCSTENNTHQCAPSSCGNIQNIRYPFRLKS
DPEACGNQMYELSCENNQAVLYLFEGKYYVQAINYNNYTIRLVDSGIQKDNYFSTPSYSL
SRYNFSLPYLHTYTTSERKGTKTSWWYPQLSRSLVLMSCEKPVNSPFYLDTSTCNYNDNS
SSISDSKRRYRYVKVGETYASQVEDSCQAEKMFLTSWPVNNDDPNISCTDVHHELAYGFE
ISWLVGICKSYCGRDIDSCYLDDANQLQCDITSIFDLGLGQILLTLLIAGWYESLYNLFT
GRQTLGRPFKNYLYIDYSYLSLNIVLIHVAAKMFLGVPCVVAFLTYKCRRRHLSMYNAIE
EFLQSQNNLMSIRHSYPEIRKITKGFMEKLGEGGYGSVFKGKLQSGQFVAIKMLGMSKAN
GQDFISEVATIGRIHHANVVQLIGFCAEGPRRALIYEFMPNGSLDKYIFPRDGRIPLSIE
KTYKISLGVARGIEYLHRGCDMQILHFDIKPHNILLDENFAPKVSDFGLAKLYHVDDSIV
SLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLLLEMTNRRKNFNEFADHSSQIYFP
TWVYEQVSKGNEIVLEDATEEEKKTIKKMILVALWCIQMKPSDRPSMNKVVEMLEGEECL
QIPSKPFLLSLEDVRDNLNPTCSSIPSGESSQSAQFQMQTM
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttcactctctcaaaaatggggagagaattacccttcactgcagggcttact
gcccttactgtttttgtattagtccataaaacttgcagcactgagaataatactcatcag
tgtgccccttcttcctgcggcaacatccagaacataagatatccgtttagattgaagagt
gatccagaagcctgcggcaaccagatgtatgaactgtcttgtgagaacaatcaagcagtg
ttatacttatttgaaggaaaatactacgtacaagcaatcaattataacaactacacaatc
cggttggtggactcaggtatacagaaggacaattacttctccactccgagttattcttta
tctcgatacaatttcagtttgccatatctgcatacatataccacgtctgagcgaaagggt
acgaagacgtcctggtggtatccccaactatcacggagtttggttttgatgagttgtgaa
aaaccggtgaattctcctttctatttggacacttctacttgcaattataatgacaactct
tcttctatatctgattccaagaggaggtatagatatgttaaagtcggtgaaacctacgca
tcccaagtggaggactcgtgccaagcagagaagatgtttcttacttcgtggccagtaaat
aacgatgacccaaatatctcctgtacggacgttcaccatgaattagcatatggttttgag
atttcgtggctcgtaggtatttgtaaaagttattgcggaagagatatcgattcttgctac
ctcgatgacgcgaaccaacttcaatgcgacatcaccagtatttttgaccttggattgggt
caaatactacttactttgctcatagcaggatggtatgaaagtctatataatttattcaca
ggaaggcagactcttgggcgcccattcaaaaattatttatatatagattatagttactta
tctctaaacatcgtattaatacacgttgcagcaaaaatgttcttgggagttccatgtgtg
gttgcctttttgacatataagtgccgtaggaggcatttatcaatgtataacgctattgag
gaatttctgcaaagtcaaaataacctcatgtcaataaggcactcttacccagaaattagg
aagatcaccaaaggtttcatggagaaattgggagaaggaggctatggctctgtatttaaa
ggaaagcttcaaagtggccaatttgtagctataaagatgttgggtatgtccaaagccaat
ggccaagactttatcagtgaagttgcgacaattggtaggattcaccatgctaatgtagtt
caacttattggcttttgtgctgagggaccaaggcgtgcccttatatatgaattcatgcct
aatggttctcttgacaaatacatttttcctcgagatggacgtatccctttaagtattgag
aaaacatacaagatttctcttggagtggctcgtgggattgaatatctacatcgaggatgt
gacatgcaaattctgcattttgatatcaaacctcataacattcttcttgatgagaacttt
gccccaaaagtttctgattttgggcttgcaaaactttatcatgtagatgatagcatagtg
tctttaactgctgcgagaggaacactaggatatatagctccagagttgttttataagaac
attggaggtgtctcctataaagctgatgtttatagtttcggcatgttattgttggaaatg
acgaatagaagaaagaactttaatgaatttgcagatcattcaagccaaatttactttcca
acttgggtttatgaacaagttagcaaaggaaatgagatagtattggaagatgccacagag
gaggagaaaaaaacaattaaaaagatgattttggtcgcattatggtgcatacaaatgaag
cctagtgatcgtccttcaatgaacaaagttgtagaaatgcttgaaggagaagaatgctta
caaataccttccaaacctttcctattatcactagaggatgtaagagataacttaaatccc
acttgctcttcaattccatcaggtgaatcaagtcaatcagctcaatttcaaatgcaaaca
atgtga

DBGET integrated database retrieval system