KEGG   Quercus suber (cork oak): 112031301Help
Entry
112031301         CDS       T05868                                 

Definition
(RefSeq) cyclin-dependent kinase D-3-like
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu03022  Basal transcription factors
qsu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    112031301
  09124 Replication and repair
   03420 Nucleotide excision repair
    112031301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:qsu01001]
    112031301
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:qsu03021]
    112031301
   03019 Messenger RNA biogenesis [BR:qsu03019]
    112031301
   03400 DNA repair and recombination proteins [BR:qsu03400]
    112031301
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112031301
    2.7.11.23  [RNA-polymerase]-subunit kinase
     112031301
Protein kinases [BR:qsu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112031301
Transcription machinery [BR:qsu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     112031301
Messenger RNA biogenesis [BR:qsu03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     112031301
DNA repair and recombination proteins [BR:qsu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     112031301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase RIO1 Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 112031301
NCBI-ProteinID: XP_023919756
Position
Unknown
AA seq 413 aa AA seqDB search
MTELDFSKKVADRYLKREVLGEGTYGVVFKAIDTKTGQTVAIKKIRLGKQKEGVNFTALR
EIKLLKELKDPNIIELIDAFPHKGNLHLVFEFMETDLEAVIRDRNIFLSPADIKSYLQMT
LKGLAICHKKWVLHRDMKPNNLLIGSNGQLKLADFGLARIFGSPDRKFTHQVFARWYRAP
ELLFGTKQYGSGVDVWAAACIFAELLLRRPFLQGSSDIDQLGKIFAAFGTPTPSQWPDMV
YLPDYVEYQYVPSPTLRSLFPMASDDALDLLSKMFTYDPKSRISVQQALEHRYFSSAPPP
TNPDKLPRPAPKRESRASDSHDGPTVLSPPRKSRRVMPERDGFEANAYQVDKVDDHVGEM
RQAAGGNTSRNEPVPMSIDFSIFGAKPPNRPTINSADRTHLKRKLDLEFQHPE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacggagctcgatttctctaagaaagtcgccgataggtatctgaagcgcgaagttctc
ggagaaggtacctatggtgtcgtctttaaagccattgatactaagacaggacagacagtt
gcaattaaaaagattcggcttgggaagcaaaaggaaggggtaaattttacggcgcttaga
gaaattaaacttcttaaagagctcaaagatccaaatataattgagttaatcgatgcgttc
ccgcacaagggtaatttgcatcttgtgtttgagttcatggagacagaccttgaagctgtt
atccgtgaccggaatatatttctatctccagctgacataaaatcataccttcaaatgaca
ctcaaaggacttgctatttgtcacaagaaatgggttttacatagggatatgaaaccaaac
aacttgttgataggatctaatggacagctcaaacttgcagattttggtttagcacgaata
tttgggagcccagatcgcaagtttactcaccaggtctttgcgcgatggtatagagcacct
gagctgttgtttggtaccaagcaatatggctctggggtggatgtttgggctgcagcatgc
atatttgctgaacttcttctgcgtcgaccttttctgcagggttcaagtgacattgatcaa
ttgggaaaaatctttgctgcatttgggactccaacaccttctcagtggcctgatatggta
taccttcctgattatgtggagtatcaatacgttccttctcccactttacggtcactgttt
ccaatggctagtgatgatgccctagatctgttatcgaagatgtttacttatgatcctaaa
tctaggatatctgtgcaacaggcattagagcatcggtacttttcatctgcgcctccacct
acaaacccggataaactccctagacctgcacctaagagggaatctagggcctcagattca
catgatggccctactgtcttatcacctccaaggaagtctaggcgagtgatgccagaacgt
gatggttttgaggcaaatgcataccaagtagataaggttgatgatcatgttggtgaaatg
agacaggcagctggtggaaatacaagcaggaatgaaccagtaccaatgtcaatagatttt
tctatctttggagcaaaacctccaaatagacctaccattaacagtgctgacaggacacat
ttgaaaaggaaattagatcttgaattccaacaccctgagtaa

DBGET integrated database retrieval system