KEGG   Quercus suber (cork oak): 112035503Help
Entry
112035503         CDS       T05868                                 

Definition
(RefSeq) uncharacterized protein At4g19900
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00601  Glycosphingolipid biosynthesis - lacto and neolacto series
qsu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    112035503
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    112035503
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:qsu01003]
    112035503
Enzymes [BR:qsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     112035503
Glycosyltransferases [BR:qsu01003]
 Glycan extension
  P blood group
   112035503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 112035503
NCBI-ProteinID: XP_023924097
Position
Unknown
AA seq 457 aa AA seqDB search
MSKYEESAKPSEPFLLSLLHQLQDLRRSILAFLLSLPTSLFALFLLLLLAYNGFSVFYIL
LPFPAKHPPVPANFLPENTAGESMKNGFSSSSKVTSLVMYAMKEEDPPMILKTHLPLLRK
THSSITPITESSVSKQRGVRKYKRKLKSVPSKARSSSFPAMIAEFFAGNSTISCKFRFFM
TWISSKSFGDRELLAMESLFKSHPNACLVIVSSSMNSKTGSQFLKPLLDKGFRVMAIDPD
FDYVFKNTYAEAWFDRLRKGNVSPGEVSLGQNLSNLLRLSLLYKFGGIYVDTDVIVLKSF
SKLRNVIGAQTINLDTGNWSRLNNAVLIFDKNHPLLYKFIQEFALTFDGNKWGHNGPYLV
SRVVSRLSGRPGFNFTVLPPSAFYPVDWSRIQSLFRGPGDKLHSKWLLKKLRHIQSQSFA
VHLWNRQSKMLKVEKGSIINQIMLDCCIFCNASISRL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagtatgaagaaagcgccaaaccttcagagcctttccttctctctcttcttcac
caattacaggacctaaggagatccatcctagcttttctcctctccttgcccacctctctt
tttgctctctttcttcttcttctcttggcctataatggcttctctgttttctacattctc
ctcccttttccggccaagcaccctcccgtacccgccaatttcctgccggaaaataccgcc
ggagaatcaatgaaaaatgggttttcttcttcctcaaaggttacttctttagtgatgtat
gcaatgaaagaagaagacccacctatgattttgaagacccatttgcctcttttgcgcaaa
acacactcttcaatcacacccattactgaatcttcagtttcaaagcagagaggggtccgg
aagtacaagcgcaagctcaagagtgtgccttccaaagctcggtcaagttcttttcctgca
atgattgctgaattcttcgctggaaattctactatttcttgtaagtttcggttctttatg
acctggatttcgtcaaagtcatttggtgatagagaattgttagctatggagagcttgttt
aagtctcacccaaatgcttgtttggtgatagtctcaagttcaatgaattcaaaaacagga
agtcaatttttaaaacctcttttagataaggggtttcgtgtaatggctattgatcctgat
tttgattatgtattcaagaatacttacgcggaggcttggtttgataggttaaggaaaggg
aatgtgagtcccggggaggtttctttgggtcaaaacctctctaatttgcttaggcttagt
ttattgtataaatttgggggtatttatgtggacacggatgttatagtgttaaagagtttc
tcaaagttgagaaatgtgattggtgcgcagactattaatcttgacactgggaattggagt
cgattgaacaatgctgtgttgatttttgacaagaatcatcctctactctacaagtttatt
caagaatttgcactaacatttgatgggaacaagtggggacacaatggcccttacttagtc
tcaagggttgtgtccaggttgagtggaaggcctggatttaatttcaccgtattgccaccg
tcggcattttatccagttgattggagtaggattcaaagtctctttcgggggcctggagac
aagctccattcaaaatggttgcttaaaaagctaaggcatattcagtctcaaagttttgca
gtgcacttgtggaataggcagagtaaaatgctgaaggttgaaaagggaagcatcatcaat
cagataatgttggattgttgtatcttctgcaatgcttcaatatcaaggttgtaa

DBGET integrated database retrieval system