KEGG   Quercus suber (cork oak): 112036158Help
Entry
112036158         CDS       T05868                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At2g23950
Organism
qsu  Quercus suber (cork oak)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal RQC
Motif
Other DBs
NCBI-GeneID: 112036158
NCBI-ProteinID: XP_023924740
Position
Unknown
AA seq 251 aa AA seqDB search
MTGKPVLDWNTRKRIAIGAARGLVYLHEQCDPKIIHRDVKAANVLLDDYYEAVVGDFGLA
KLLDHADSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAFEFGKTV
NQKGAMLEWVKRIQQEKKVEVLVDRELGSNYDQIEVGEMLQVALLCTQYLPAHRPKMSEV
VRMLEGDGLAEKWAASHNNTNPSMNHFHTNTNPAASKHDDNGHDRSSMFGAGEDDDEHSL
DSFAMELSGPR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaaaaccagtacttgactggaacacaaggaagagaatagcaattggagctgct
aggggtcttgtttatctacacgagcaatgtgatccaaagataatccaccgagatgtaaag
gctgctaatgtgctcctggatgattactatgaagcagttgttggtgatttcggccttgca
aagctccttgaccatgcagactctcacgttaccactgctgtccgaggcactgttggccat
attgcaccagagtacctctctactggccagtcatctgagaaaactgatgtgtttggattt
ggcattctcttgttagagctcataactggaatgagagcttttgagtttggcaaaactgtt
aatcagaaaggagccatgcttgagtgggtgaaaagaatacaacaggagaagaaagtggaa
gtgttggtggacagagagcttggaagcaactacgaccagatagaggtgggggagatgctg
caagtagctttgctatgcactcaatacttgccagcccaccgccccaagatgtcggaagtg
gtccggatgctcgaaggtgacggcctggccgagaagtgggcagcatcacacaataatacc
aatcccagtatgaaccactttcacactaacactaatcccgctgcatcaaaacatgatgac
aatggtcatgatcgttcaagcatgtttggagctggtgaggatgatgatgaacattccttg
gattcctttgccatggaactctctggtccaagatag

DBGET integrated database retrieval system