KEGG   Quercus suber (cork oak): 112036754Help
Entry
112036754         CDS       T05868                                 

Definition
(RefSeq) cytosolic phospholipase A2 zeta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00564  Glycerophospholipid metabolism
qsu00565  Ether lipid metabolism
qsu00590  Arachidonic acid metabolism
qsu00591  Linoleic acid metabolism
qsu00592  alpha-Linolenic acid metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    112036754
   00565 Ether lipid metabolism
    112036754
   00590 Arachidonic acid metabolism
    112036754
   00591 Linoleic acid metabolism
    112036754
   00592 alpha-Linolenic acid metabolism
    112036754
Enzymes [BR:qsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     112036754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 112036754
NCBI-ProteinID: XP_023925345
Position
Unknown
AA seq 789 aa AA seqDB search
MSRSMRWSHMTSKQRALVSNLLLGSSTIFAYSVFLRHNSALCLDSEQPPKDWLFRRTSIV
SHNRPLSDRAQDSAESGGRPRKSSGTAQKDHRIETTASGPRSQVAFDTKECSYVDSLAAW
HTATARVSAVCGSLADFDISSLGDKLTDMLVPAWVRTLPSWITKLQNELSMAPWSLSWEI
WEEAHDPEINPEIIWDAQVRISPDLCVEEQTFLHRRLPQTAKALARYLDVPESEVHPDDV
PIIAMCGSGGGLRALVAGGSSFLSTQEAGLFDCVTYTAGVSGSCWLQTLFNSSIGKQNYA
NIIAHLKDRIGIHIASPPALLAQLSQAPTNKFLLSGFVEKLRGVPDADFGLVDVYGLALA
ARLMVPRGELRIDNYDMKVSNQRRFIDQGQGPLPIYTAVRHELPEPPVDLDEAPRFGVKK
RDSFQWFEWTPFEFYCEELEAGIPSWAVGREWDGGATVWRDNGLALPELRVPLYLGIWGS
AFCATLSHYYKEIRPIILASGMSGLDALLTGKDEDLVKVHPIDPAVIPNFARGLRDRLPA
TAPAGIHTATHLQLMDAGMNNNLPIYPLLRPSRHVDLIIAFDASADVRGDNWVAAVRGYA
QTRGIPGWPMHAGWPSSSSAEDLSHCTVWAGSRSPTPPSSTSSSAIPPQQLTPTSPPAAI
AALLGAPDAGTTLVYFPLLANPAAAPGLDPARDAFASTWNFVYTPAEIERVVGLARANFG
VGAGLTRAAVRAVWERKRAARRERERLGGGVVAGGSVCGLRGGQGGGKPYALCPRAVEEE
GRPDVGRET
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtagtatgcgatggagccatatgaccagcaaacagcgcgcgttggtgtcaaat
ctgcttttggggtcctccaccatctttgcctacagcgtatttcttcgccacaattctgca
ttatgtcttgacagcgaacaacctccgaaggattggctgtttcgtagaactagcatagtt
tcgcacaaccgacctctctccgaccgggctcaagattctgccgaatccggcggtcgtccg
cgcaaatcaagtggaactgcccagaaggatcaccgaattgagaccacagcttcaggaccc
agaagccaagttgcgtttgataccaaagaatgttcctacgtggacagtctagcagcatgg
catactgcaacagcgcgcgtttctgccgtatgtggctcactggcagatttcgatatctcc
agtcttggtgacaagcttacagacatgctggtgccggcatgggtgcgtacattaccgagc
tggatcacaaagctgcagaatgaattgtccatggccccctggagtctgtcctgggagatc
tgggaagaagcacatgacccggaaatcaatcctgagatcatctgggatgctcaagtcaga
atatctcctgatctctgtgtggaagaacaaacctttctacaccgacgactaccacagacg
gccaaagctctggcgcgatatctcgacgtgccagagtccgaagtacatcctgacgacgtg
ccgatcatcgcaatgtgcggctcgggtggaggactacgagcactcgtcgctggtggatct
tcatttttgtccacacaagaagcaggtctcttcgactgtgtgacgtacacagcgggcgtc
agcggaagctgctggctacaaactctgtttaactcgtctattggaaagcaaaattatgcg
aacatcatcgcgcacttgaaagaccgcatcggcattcacattgcctccccgccagcctta
ctggcccaactgagccaagcacccaccaacaaatttcttctttccgggttcgtggagaag
ctgcgcggcgtgcccgatgcagacttcgggttggtcgacgtctatggcctggcacttgcg
gcgcgactgatggttccgcgaggcgaactccgtatcgacaattatgacatgaaagtgtcg
aatcagcgtcgtttcatcgatcagggtcaaggaccgttgcctatctacactgcggtgcga
cacgaattaccagaaccacccgtcgacttggatgaagccccaaggttcggagtgaagaag
cgagactccttccaatggttcgaatggacgccattcgagttctactgcgaagagctcgag
gccggcatacccagctgggctgtcgggcgcgagtgggacggcggcgcgacggtctggcgc
gacaacggcctcgcgctgcccgagctgcgggtcccgctctacctgggcatctggggcagc
gccttctgcgccacgctctcccactactacaaagagatccgccccatcatcctcgcctcc
gggatgagcgggctcgacgccctgctcaccggcaaggatgaagacctggtcaaagtgcac
cccatcgacccggccgtcatcccgaacttcgcgcggggcctgcgcgaccgcctgcccgcg
accgcccccgccggcatccacaccgccacccacctgcagctcatggacgccggcatgaac
aacaacctgcccatctacccgctgctgcggcccagccgccacgtcgacctgatcatcgcc
ttcgacgcctccgccgacgtccgcggcgacaactgggtcgccgccgtgcgcggctacgcc
cagacccgcggcatccccggctggccgatgcacgccggctggccctcctcttcctccgcc
gaagacctgtcccactgcaccgtctgggccggctcgcgctcccccaccccaccgtcttct
acctcctcctccgcgattccaccgcagcagctaaccccgacctccccacccgccgccatc
gccgccctgctcggcgcgcccgacgccggcacgacgctcgtgtactttccgctgctcgcg
aacccggccgcggcgccgggcctcgacccggcgcgcgacgcgttcgcgtcgacgtggaat
ttcgtgtacacgccggcggagatcgagcgggtggtggggctggcgcgcgcgaactttggc
gtcggcgcggggctgacgcgcgcggcggtgcgcgcggtatgggagcggaagagggcggcg
cggcgtgagcgggagcggctgggcggaggagtggtggcggggggatcagtttgcgggctg
agggggggtcaagggggtggaaaaccttatgctctgtgcccgagggcggtggaggaggag
ggtcgtccggatgtgggacgggagacatag

DBGET integrated database retrieval system