KEGG   Quercus suber (cork oak): 112036833
Entry
112036833         CDS       T05868                                 

Definition
(RefSeq) nitrite reductase [NAD(P)H]-like
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00910  Nitrogen metabolism
qsu01100  Metabolic pathways
Module
qsu_M00531  Assimilatory nitrate reduction, nitrate => ammonia
qsu_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    112036833
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     112036833
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske_2 Pyr_redox Rieske Fer2_BFD NIR_SIR_ferr Rubredoxin_C NAD_binding_9 Pyr_redox_3 Amino_oxidase K_oxygenase 2-Hacid_dh_C Tsp45I
Other DBs
NCBI-GeneID: 112036833
NCBI-ProteinID: XP_023925424
Position
Unknown
AA seq 1118 aa
MSNSEWNDPEANVLPDKVEKLVEMDEIPKNTKRKRVVVVGLGMVGVAFIEKLMKLDVKRR
EYDVIVIGEEAHLAYNRVGLTSFFQHREVENLYLNPASWYASMPEGSLNYHLNSLVTSID
TEKKSVETAQGQTVPYDILVLATGSDALLPRHTPGYDANGVFVYRTIDDLQKLISFATTK
TGTTGAVVGGGLLGLEAAKAMMDLEEFSKVKLIERNRWVLSRQLDGDAGLMVVEQVRALG
LDVLLSKRVGKINTDAENNVTGVTFEDGESMDCTCICFAIGIKARDELARKSGISCADRG
GGIIINPDMSTSVPDVYAIGECASWESQTFGLIAPGIEMADILAFNLTQVGSHTPRKFSS
PDLSTKLKLLGVEVASFGDFFADRDGPKSASVSRRGAKKEGNAEGQDRVKSLTDGPPPPA
VKALTYKDPFQQIYKKYLFTVDGKYLLGGMMIGDTKDYVKLVPMVKKKQALQVPPSEFIV
GAKGDDNGDDLDDDVQVCSCHNVTKGDVAKSVKDGTCKSIGDVKSCTKAGTGCGGCMPLV
QTIFNKTMESMGQEVKNHLCPHFDYSRADLFNIIYVKHLETFPEIMKECGKDANSTGCEV
CKPAIGSITASLFNKHVLDKDRRGLQDTNDRFLANIQRNGTYSVVPRVAGGEITAERLII
LGTVAKKFGLYCKITAGQRVDLFGARKNDLPLIWKELIEGGMESGLAYAKSLRTIRSCVG
STWCRYGLHDSVGMAIRLEERYKSIRSPHKMKGGVSGCVRECAEAQNKDFGLVATDKGWN
IYVGGNGGATPRHCELLAKDVVTDDVVPILDRYLAFYIRTADRLQRTARWIENLPGGIAY
LREVILEDRLGLCADLEKQMQDLIGSFFCEWTEALKRPDIMQNFAQFANTDETLEAIEKV
EDRTQQRPAYWPKESATENFRGTEWSELSWQPLAKCEQFVDTPTGSSVAVKRGDTQLAIF
KVKGKYYATQQMCPHKRAFVLSDGLIGEDVENNKLWVSCPLHKRNYTLGGENAGGCSTDE
TVNIATFPVEAREDGLVYVKLPPIEELDSVLGTEKWKVRKEETEVKGPFEEMDKKFDAMK
MKGRKSINASHLQNGLGSEGKARSILAGGERGANGMDW
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgagtaacagcgagtggaacgatcccgaggccaatgtcctaccggacaaggtcgagaaa
ctcgtcgagatggatgagatccccaagaacaccaagagaaagcgcgtcgtggtggtcggg
ttggggatggtgggagtcgcattcatagagaagctgatgaagctcgacgtgaagaggaga
gagtacgatgtgattgtgattggagaagaagcacatttggcatataacagagtcggcttg
accagctttttccagcatcgagaagtcgagaacctctacctcaacccagcgtcatggtat
gcctccatgcccgaaggctcactgaattaccacctcaattccctcgttacgtcgatcgat
acggaaaagaaatccgtcgagactgcacaaggtcagaccgtcccgtacgatatcctcgtc
cttgctactggttcggacgcattgttaccaagacacactcccggttacgacgcaaatggc
gtcttcgtctatcgtacgatcgacgatttacagaagttgatctctttcgccactaccaag
actggtaccacaggcgcagttgtaggaggtggcctactcggcctagaagcagccaaggct
atgatggatttggaagagttctccaaagtcaagctcattgaacgtaacaggtgggtgctc
agcagacagctggatggagatgccggtttgatggtggtcgaacaagtccgagctcttggg
ttggacgtacttctcagtaaacgagttggcaagatcaataccgatgcagagaacaacgtg
acaggtgttactttcgaagacggcgaatcgatggactgcacttgcatttgcttcgccatt
gggatcaaagcaagagacgagctcgcccggaagtctggcatcagctgcgccgatcgtggt
gggggcatcatcatcaacccagacatgtccacgtctgtcccagatgtgtacgcaatcgga
gaatgcgccagctgggaaagtcagacattcggtctcatcgcaccgggaatagagatggcg
gacatcctcgcttttaaccttactcaagtgggatctcacacacctcgcaaattcagcagc
ccggacctgagtacgaagttgaagcttctgggtgtcgaagtcgcaagtttcggggacttc
ttcgcagatcgcgacgggcccaaatcagcttctgtatctcgacgtggcgcaaagaaggag
ggtaatgccgaaggccaggatcgtgtgaagagcctcactgacgggccacctcctcctgct
gtgaaggctctgacctacaaagacccattccagcagatttacaagaagtacctgtttaca
gtagatggaaaatatcttcttggtggtatgatgataggagacaccaaagactatgtcaag
ctcgtgccgatggtcaagaagaagcaggcccttcaggtcccccccagcgagttcatcgtc
ggcgccaagggtgatgacaacggggatgatctcgatgatgatgtacaggtctgctcttgc
cataacgtcaccaaaggcgacgttgcaaagagtgtgaaggatggtacttgcaaatctatc
ggcgacgtcaagtcttgcacaaaagccggtactggctgcggagggtgcatgccgctcgtg
cagacaatcttcaacaagaccatggaatcgatgggccaggaggtcaagaaccatctatgc
ccccactttgactactcacgtgcggatctgttcaacatcatctatgtcaagcatctcgag
acatttcccgagatcatgaaagagtgcggtaaagatgcaaactcgaccggttgcgaagtt
tgcaaacccgccatcggctccatcactgcatctctcttcaacaagcacgttctcgataaa
gatcgacgaggtctgcaagataccaacgaccgattcttggccaacattcaacgtaacggt
acatactctgtcgtgccgcgcgttgctggaggcgaaatcaccgcagaaaggcttatcatc
ttaggtacggtggccaaaaaatttggactgtattgcaaaatcactgctggtcaaagagtg
gatctgtttggcgcccgcaaaaacgatttgccgttgatctggaaggaattgatcgaaggt
ggaatggagtccggcttggcgtacgccaaaagtttgcgaacgatacggagttgtgtgggt
tcaacttggtgtcggtatggactgcacgatagtgttggaatggcgatacgattggaagag
cgatataagtcgatccgatctcctcacaaaatgaagggcggggtgtccggttgtgtacga
gagtgcgcagaagcccagaacaaggatttcggattggtcgccactgacaaaggatggaac
atatatgtcggtggcaatggaggcgccacgcctagacactgtgagctactggcaaaggac
gtagtcactgacgacgtggtccccatcctggacagatacctggcattctacattcgtacg
gccgaccgtcttcaacgcaccgcgcgctggatcgagaacctacctggtggtatcgcgtat
ctccgcgaggtcatccttgaagaccgacttggattatgtgcagatctcgagaaacaaatg
caggatctgatcggctcgttcttctgcgagtggaccgaggcgctgaaaagaccagatatc
atgcagaactttgcgcaattcgccaacactgacgaaacgctggaagccatcgaaaaggta
gaagaccgcacccagcaacgtccggcctactggccgaaagagtccgcgacagagaatttc
cggggcacagagtggagtgagcttagttggcagcctctcgccaagtgcgagcagtttgtc
gacacgcccacggggtccagcgtggcggtcaagcgcggcgacacgcagttggcgatcttc
aaagtcaagggcaagtactacgccacgcagcagatgtgtccgcacaagcgcgcgtttgtg
ctcagcgacggactgatcggcgaggatgtggagaacaacaagctttgggtatcgtgcccg
ctgcataagcgcaactacacgcttggaggtgaaaatgccggaggttgcagcaccgacgag
accgtcaacatcgcgacgttcccggtcgaggcccgggaggacgggctggtgtacgtcaag
ctcccgcccatcgaggagctcgatagcgtgctcgggaccgagaagtggaaggttcgcaag
gaggagacggaggtcaagggcccgttcgaggagatggataagaagttcgatgccatgaag
atgaagggtcgcaagagtatcaacgcaagtcatctgcagaatgggctgggctcggaaggc
aaagcccgctcgattctggcaggtggtgagaggggcgcgaacggcatggattggtga

DBGET integrated database retrieval system