KEGG   Quercus suber (cork oak): 112036963Help
Entry
112036963         CDS       T05868                                 

Definition
(RefSeq) siroheme biosynthesis protein met8-like
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00860  Porphyrin and chlorophyll metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Module
qsu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    112036963
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     112036963
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     112036963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_C Sirohm_synth_M Pyr_redox_3 Shikimate_DH Pyr_redox K_oxygenase
Motif
Other DBs
NCBI-GeneID: 112036963
NCBI-ProteinID: XP_023925554
Position
Unknown
AA seq 255 aa AA seqDB search
MAPSFPEVQGGGSLILAWQVKNKKVLVVGGGEVAAGRILNLLNADAKVTLVSPRSGLNPE
VAHRIERNQVTYIDRLFEPSDLDDPELTMVLTAIDDPEASSQIWKLCKQKRIAANIADVP
PECDFYFGSVHRDGPLQIMVSTNGNGPKLAALVRKKIADELPQNLGSAIQKVGMLRKKLR
TVAPGSDEGPKRMGWMSRVCVDWSLEDFCGMTDEDMDGLLKGYGPNEVPSLDQVRLGENT
GVPEFDASFGWCCVI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccccctccttccccgaggtgcaaggtggaggctcgttgatcctggcttggcaagtc
aagaacaagaaggtccttgtcgttggaggtggcgaagtcgctgctggtcgcattctcaat
ctactaaatgccgatgctaaagttacactggtgtcaccgcgctctgggctgaatccagaa
gttgcccaccgcattgagcgcaaccaagtcacctatatcgataggcttttcgagccgtca
gatcttgacgatccagaactcaccatggtccttaccgccatagacgacccagaggctagt
tctcagatctggaaactgtgtaaacaaaagcgcatagcggccaacatcgctgacgtacca
ccggaatgcgatttttattttggctcggtccatcgcgatgggccacttcagataatggtg
tcaacgaatggcaatggcccgaaactggcggcacttgtaagaaagaagattgcggacgag
ctgcctcaaaacctaggaagcgcgattcagaaggttggtatgttgaggaagaaactgaga
actgtcgcaccaggcagtgacgaagggccaaagcggatgggatggatgtcaagagtttgt
gttgactggagtctcgaagatttctgtggaatgactgacgaagacatggatggactgctc
aaaggctatggtcctaatgaagtgccgagcctcgatcaagtgagattaggcgagaacacc
ggagtgccagaattcgatgccagttttggatggtgttgtgtaatatag

DBGET integrated database retrieval system