KEGG   Quercus suber (cork oak): 112038692Help
Entry
112038692         CDS       T05868                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 1 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00061  Fatty acid biosynthesis
qsu00071  Fatty acid degradation
qsu01100  Metabolic pathways
qsu01212  Fatty acid metabolism
qsu04146  Peroxisome
Module
qsu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    112038692
   00071 Fatty acid degradation
    112038692
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112038692
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:qsu01004]
    112038692
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:qsu04147]
    112038692
Enzymes [BR:qsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     112038692
Lipid biosynthesis proteins [BR:qsu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   112038692
Exosome [BR:qsu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   112038692
  Exosomal proteins of breast cancer cells
   112038692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 112038692
NCBI-ProteinID: XP_023927295
Position
Unknown
AA seq 666 aa AA seqDB search
MIMIMRFTIWKKMKVFSAKVEEGREGLDEKPAVGPVYRNLLSKNEFPPPDPNISTAWDVF
SVSVEKNPQNRMLGWRKFVDGKLGPYVWKTYKEVYDEVMCIGSALRASGAEPGSRVGIYG
SNCPQWIMAMEACNAHSLVCVPLYDTLGPGAVNFILDHAEVDFVFVQDKKVKELLNPDCK
SAQRLKIMVCFTSLTEEEKNKAAEIRIKPYSWNEFLHMGKETPSEICPPQAFHIGTIMYT
SGTSGDPKGVVLTHENIASFIRGMDLFMAQFEDKMNEDDVYLSFLPLAHILDRVIEEYFF
RNGASVGYYHGDLNALLDDLMELKPTLFGGVPRVFERVHEGIKKALQELNPVRRKFFDIL
YRHKLAWMKFGCKQKNASPLADLLAFRKIKARLGGRVRLILSGGAPLSSEVEEFLRVTCC
AFVVTGYGLTETCGPTTMGFPDEMCMIGTAGTPTLYNELRLEEVPEMGYNPLGERACGEI
CVRGKSVFSGYHKNPELTRESIKDGWFHTGDIGEMLPNGVVKIIDRKKNLIKLSQGEYVA
LEHLENVYVITPIVEDIWVYGNSFKSKLVAVVIPHEENAKKWAYSNGHVGSFAELCSLDQ
LKNYVLAELKFTAERNKLRGFEQIKGIILDPLPFDMERDLVTATMKKKRNKLLKLYQAQI
DKLYGI
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgattatgataatgcgtttcacaatttggaaaaaaatgaaggttttttcagctaaggtt
gaagagggaagggaaggcctagatgagaagccagcagttggtcctgtgtatcgtaattta
ctctccaagaatgagtttcctccacctgatcccaatattagtacagcttgggatgttttc
agcgtatctgtggagaagaatcctcaaaataggatgcttggatggcgtaaatttgttgat
gggaagctaggaccttatgtatggaagacatacaaggaagtttatgatgaagtcatgtgt
attggttctgcattacgagcatctggtgctgaacctggctcccgggttgggatttatgga
tcaaactgccctcagtggataatggccatggaggcttgcaatgcccacagtttggtttgt
gtgcctctttatgatacccttgggccaggtgctgtcaattttattctcgatcatgcagag
gttgattttgtttttgtccaggataaaaaagtgaaagaactactaaatcctgattgtaaa
tctgctcaacggctgaaaattatggtgtgcttcacttccttgacagaggaagagaagaat
aaggcagctgaaattaggataaaaccatattcatggaatgagttccttcatatgggaaaa
gaaaccccgtcagagatttgtccacctcaggctttccacattggcacaattatgtacaca
agtggcacaagtggagatcctaaaggtgttgtgttaacacatgagaacattgcctctttt
ataagagggatggatctatttatggcacaatttgaagacaagatgaatgaagatgatgtg
tatctttctttcctgcccctggctcatatccttgatcgcgtgattgaagagtatttcttc
cgtaatggtgcttctgttggctactatcatggggatcttaatgcattgctggatgatttg
atggagctgaagccaacactctttggtggggtaccacgagtttttgaaagagtgcatgaa
ggtataaaaaaagcattacaagaactcaatccagtaaggagaaaattttttgacattcta
tacagacacaaacttgcttggatgaagtttgggtgtaaacagaaaaatgcatcaccgtta
gctgatctgttggcattcaggaagattaaagccagattaggtggtcgggtccggctaata
ttatctggaggagcacccttgagctctgaggtggaagaattcttgcgggttacttgttgt
gcctttgttgtcacaggttatgggttgacagaaacttgtggaccaactactatgggcttt
cctgatgagatgtgcatgattggtactgccggtacccctactttgtacaatgagctacgc
ctggaggaggtcccagagatgggttacaacccacttggggagcgagcatgtggtgagata
tgtgtaagagggaagagtgtcttttccgggtaccacaaaaatcctgaattaacaagagag
tccatcaaagatggctggtttcatacaggggacataggggaaatgcttccaaatggagtt
gttaagattatagatagaaagaagaatctcataaaactttcccaaggagagtatgttgca
ctagagcatttggaaaatgtttatgttatcactccaattgttgaagatatctgggtatat
ggaaacagctttaagtcaaagctagttgcagtagttataccacatgaagaaaacgccaaa
aagtgggcatattcaaacggtcatgtgggttcattcgccgaactgtgttcccttgatcag
ttaaagaattatgtgctcgctgagctgaagtttactgctgagagaaacaagctgagaggt
tttgaacaaatcaaaggaatcattctagatccccttccctttgatatggaaagagatttg
gtaacagcaacaatgaagaagaaaagaaataagttgctcaaattgtatcaggcacaaatt
gacaaactctatggaatttga

DBGET integrated database retrieval system