KEGG   Quercus suber (cork oak): 112039060Help
Entry
112039060         CDS       T05868                                 

Definition
(RefSeq) probable glycosyltransferase At3g42180 isoform X1
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:qsu01003]
    112039060
Enzymes [BR:qsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     112039060
Glycosyltransferases [BR:qsu01003]
 Polysaccharide
  Structural polysaccharide
   112039060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin
Motif
Other DBs
NCBI-GeneID: 112039060
NCBI-ProteinID: XP_023927667
Position
Unknown
AA seq 364 aa AA seqDB search
MSKKKETFIPRGSIYRNPYAFHQSHIEMLKRFKVWTYGEGEKPLVHSGPLKDAYAIEGQF
IDEIESYKSPFRACNPEEAHVFFLPISVTNIVDYVYMPITTDADFYRDRLQKIAMDYVKV
VANKHPYWNRSNGADHFMLSCHDWAPDISVADHELFENLIRAHCNANTSEGFQPIRDISI
PEIYIPNGTLGPLLQGQGPNNRPILAFFGGQAHGDIREILLKNWKDKDSDVQVHEYLPQG
PNYTKIMSRTKYCLCPSGFEVASPRVVEAIYKGCVPVIISDSYHLPLSDVLNWGRFSIQI
PVEKIPEIKTILQGIPYEKYKKLQKNVIKVQRHFVLNRPAKPFDVLHMVLHSVWLRRLNF
ALPA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaagaaagagacctttatccctagaggttccatttacagaaatccatatgct
tttcatcagagccacatagagatgttgaagaggttcaaggtgtggacctatggagaagga
gagaaacctttagtccacagtggaccattgaaggacgcgtacgccatagaagggcaattc
atagatgaaatagaaagctataaaagtcccttcagggcttgcaatcctgaagaggcacac
gtatttttcttgcccattagcgtaaccaatattgttgattatgtttatatgcctatcacc
acagacgcagacttctatcgtgatcgtctgcaaaagattgcgatggactacgttaaggtc
gttgcaaataagcacccttactggaacagaagcaatggtgctgaccatttcatgctttca
tgtcacgattgggcaccagatatctcagttgccgaccatgaactcttcgagaatttaatt
agggcccattgtaatgctaacacatctgaaggatttcaacccattagagacatctcaatt
cctgaaatttacatacctaatggaacacttggcccacttcttcagggccagggcccaaac
aaccgcccaatcctcgccttctttggtggtcaggctcatggggacattcgtgaaatctta
ctaaagaattggaaggacaaagacagcgatgtacaggtccatgagtaccttcctcaaggc
ccaaattacaccaaaataatgagccgaactaagtattgtttgtgtcctagtggattcgaa
gtggctagtcctagagttgtggaagcaatatacaaagggtgtgttccagttataatttct
gatagttatcatctaccattgagtgatgtcctcaattggggtcgattttcaatacaaatt
ccagtggaaaagattccagaaattaagacgatcttgcaagggattccctatgagaagtac
aagaaattgcaaaagaatgtaataaaagtgcaaaggcattttgtgctaaaccggcctgct
aagccatttgatgtccttcacatggtgcttcactcggtttggttgaggagacttaacttc
gcactccctgcttga

DBGET integrated database retrieval system