KEGG   Quercus suber (cork oak): 112039301Help
Entry
112039301         CDS       T05868                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
qsu  Quercus suber (cork oak)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:qsu04131]
    112039301
Membrane trafficking [BR:qsu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    112039301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPACA9
Motif
Other DBs
NCBI-GeneID: 112039301
NCBI-ProteinID: XP_023927929
Position
Unknown
AA seq 401 aa AA seqDB search
MQNVICTAVLKQWSSIALKVVDFVVALFLYSLYTVSSIICDHDLFVEMPGRDPSDSISTL
YLDKFSGVCQMVLHDCKLTFLQIICDHDLFVEMPGRDPSDRNYLSSVLIQEIFLTWDHDD
LSLRAKAARILVVLLCKHEFDARYQKPEDKLYIAQLYFPLIGQILDEMPVFYNLNAVEKR
EVLIVILQIVRNLDDASLVKAWQQSIARTRLFFKLLEECLVLFEHRKPADGMLMGCSSRS
PVGDGPASPKYSDRLSPAVNNYLSEASRQEVRISLYLDKFSGAKWFSMTASLHFCRLYIL
DEMPVFYNLNAVEKREVLIVILQIVRNLDDASLHRKPAAGMLMGCSSRSPVGDGPASPMD
SDRLSPAVNNYLSEASRQEVRRSFYCFMQTSRLRVMLIITF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgtgatttgtacagctgtactaaagcagtggagctctattgccctgaaagtg
gtggactttgttgttgccctttttctatactctctttacacagtttcttctattatatgt
gatcatgacctttttgtggaaatgcctgggagagacccttcagatagcatctcaacgttg
taccttgacaagttttctggggtgtgccaaatggttctgcatgactgcaagcttacattt
ttgcagattatatgtgatcatgacctttttgtggaaatgcctgggagagacccttcagat
aggaactacctttcatctgtcttgatacaggagattttccttacttgggatcatgacgat
ttatctctgcgggcaaaggcagctagaatattagtagtcctcttgtgcaagcatgagttt
gatgctcgataccaaaagcctgaagataagctatatattgcacagttatattttccactt
attggacagatcctagatgaaatgcctgtcttttacaacctaaatgccgttgaaaagcgt
gaagttttaattgttattttgcaaattgtgcgcaatctcgatgatgcatcacttgtaaaa
gcgtggcaacaaagcatcgctcggactagattatttttcaaactcttggaggaatgctta
gttctttttgagcatagaaaacctgctgatggcatgctcatgggctgtagttctcgcagc
ccagttggggatgggcctgcttcccccaagtactctgatagactttctcctgcagttaac
aattatctatctgaggcatcaagacaagaagtcagaatttccttgtaccttgacaagttt
tctggtgccaaatggttcagcatgactgcaagcttacatttttgcagattatatatccta
gatgaaatgcctgtcttttacaacctaaatgccgttgaaaagcgtgaagttttaattgtt
attttgcaaattgtgcgcaatcttgatgatgcatcacttcatagaaaacctgctgctggc
atgctcatgggctgtagttctcgcagcccagttggggatgggcctgcttcccccatggac
tctgatagactttctcctgcagttaacaattatctatctgaggcatcaagacaagaagtc
agaaggtccttctattgcttcatgcagacatcaaggttaagggtcatgctgattatcaca
ttttga

DBGET integrated database retrieval system