KEGG   Quercus suber (cork oak): 112040683Help
Entry
112040683         CDS       T05868                                 

Definition
(RefSeq) glutathione transferase GST 23-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00480  Glutathione metabolism
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112040683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:qsu02000]
    112040683
Enzymes [BR:qsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112040683
Transporters [BR:qsu02000]
 Other transporters
  Pores ion channels [TC:1]
   112040683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 112040683
NCBI-ProteinID: XP_023929342
Position
Unknown
AA seq 237 aa AA seqDB search
MASSAMVTANQLIIMAELKLFRTWSSPFALRVVWALDFKGIQYDTIFEDLSNKSSLLLQY
NPIYKKVPVLVHNGKPLLESLVILEYIDETWKQNPLLPEDPSERATARFWAKFGDDKVLP
SIWNAFIKQGKDQEEAIVTAQENLGFVERQLTGKKFFNGETIGLLDLAFGWLANLPSVLE
EVCGVTLIDHEKFPLLLEWIQNFADAPIIKESWPPRDKLITKYQALHEVYTSKEATK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcctcatcagctatggtaacagcaaatcaactcataataatggcagaactgaagctc
ttcagaacttggtcaagtccctttgctctaagggttgtttgggcactagacttcaagggc
attcaatatgataccatatttgaagatctctccaacaagagctctttacttcttcagtat
aatcctatctacaagaaggtaccagtgcttgttcacaatggaaaaccattactggagtca
cttgtaattcttgaatacatcgatgagacatggaagcaaaatccgttactgcctgaagat
ccttctgaacgagccacggcacgcttttgggccaaatttggagatgataaggttttgcca
tcaatatggaatgcttttatcaagcaagggaaggatcaagaggaagctatcgttacagcc
caggagaacttgggatttgtagaaagacagcttactggaaaaaaattcttcaatggagag
acaattggacttttagaccttgcttttggttggcttgctaatttgccaagtgtattggag
gaggtatgtggtgtgaccttgatagatcatgaaaaatttcccttgttattagaatggatc
cagaatttcgcagatgctccaataattaaagaaagctggccccctcgagacaaactgatc
accaaataccaagctcttcatgaagtttatacttcaaaagaggcaacaaaatga

DBGET integrated database retrieval system