KEGG   Rahnella aquatilis HX2: Q7S_03150Help
Entry
Q7S_03150         CDS       T01850                                 

Gene name
surE
Definition
(GenBank) 5'(3')-nucleotidase/polyphosphatase
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00230  Purine metabolism
raa00240  Pyrimidine metabolism
raa00760  Nicotinate and nicotinamide metabolism
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:raa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Q7S_03150 (surE)
   00240 Pyrimidine metabolism
    Q7S_03150 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Q7S_03150 (surE)
Enzymes [BR:raa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Q7S_03150 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AFE56893
UniProt: H8NR62
Position
691776..692540
Genome map
AA seq 254 aa AA seqDB search
MRILLSNDDGVLAPGIQALASALREFADVTLVAPDRNRSGASNALTLDGPLRIQSYPNGD
TAVINGTPTDCVYLGVNTLMRPKPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLDGHQHYDTAAIITCRILRALAREPLRTGKILNINVPDLPLSQIKGIKVTRCGSRH
PAEQVFCQQDPRGQDLYWIGPPGDKFDVAPDTDFAAVAQGYVSVTPLQVDLTAYAAQDVV
VSWLEKAGVSANGE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcggatattactgagtaacgacgacggcgtactggctccgggtatacaggcgctggcg
tcagcactgcgtgaatttgctgacgtgacgctggtggcccctgatcgtaaccgtagcggc
gcatctaatgcgttgacgctggacggcccgttgcgtattcagtcttaccctaacggggat
accgccgtaattaacggtacgccgaccgattgtgtgtatcttggcgtgaatacgctgatg
cgccctaagccagatatagtggtctctggcatcaatgcggggccgaatctgggtgacgac
gtcatctattccggtacggtcgccgccgcgatggaaggccgccatctgggctttcccgcg
ctggcggtctcactggacggccatcagcattatgacacggcggcgatcatcacctgtcgg
atcctcagggctctggcgcgtgagcctttgcgtactggcaaaattctgaatattaacgtc
ccggatttgccactttcgcagatcaaggggatcaaggtgacgcgttgcggtagccgtcat
ccggccgagcaggtattttgtcagcaggacccgcgtggtcaggacttgtactggattggc
ccgccgggggataaatttgatgtcgcacctgatactgattttgctgctgtcgcgcaaggt
tatgtttcagtgacgccacttcaggtggatttaaccgcctatgcggctcaggatgtcgtg
gtctcatggttggaaaaggccggggtgagcgcgaatggtgaataa

DBGET integrated database retrieval system