KEGG   Rahnella aquatilis HX2: Q7S_05935Help
Entry
Q7S_05935         CDS       T01850                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
raa  Rahnella aquatilis HX2
Pathway
raa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:raa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Q7S_05935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:raa02000]
    Q7S_05935
Transporters [BR:raa02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Q7S_05935
   Histidine transporter
    Q7S_05935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFE57433
UniProt: H8NMV4
Position
1272308..1272994
Genome map
AA seq 228 aa AA seqDB search
MLYGYSQVIIQGTLVTLELAISSVILALVIGLIGAGGKLSKNRIVSGFFGCYTTLIRGVP
DLVLMLLIFYGLQIALNSVTESLGLTQIDIDPMSAGIITLGFIYGAYFTETFRGAFMAVP
RGQIEAATAFGFSGSQIFRRILFPAMMRFALPGIANNWQVILKATALVSLLGLNDVVKAT
QLAGKGTYQPFYFAIVAGVVYLIFTTLSNGVLVWLDRRYSLGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatgggtattcccaggtaattatccagggcacgttagtgacactggagctggcg
atttcgtcagtcattctggcgctggtgatagggttaatcggcgcgggcgggaaactgtca
aagaaccggatcgtgtctggtttttttggttgctacaccacgcttattcgcggcgtacct
gatctggtattaatgttattgattttctacgggttgcagattgcgcttaacagcgtcacc
gaatcactgggattgacgcaaattgatatcgatccgatgagcgccggtattatcacgctg
ggctttatctacggggcttatttcactgagacgttccgtggtgcgtttatggcggtcccg
cgtggacaaatcgaagctgcgacggctttcgggttcagcggttcacagattttccgacga
attttatttccggccatgatgcgctttgcactgccgggtattgccaacaactggcaggtt
attctcaaagccaccgcgctggtgtccttgctgggtctgaatgatgtggtcaaagccacg
caactggccgggaaaggcacgtatcagccgttctattttgcgattgtggcgggagtggtt
tatctgattttcaccacgctgtcgaacggcgtgctggtatggcttgatcgccgttattcg
ctgggtgtgaagagggctgatctatga

DBGET integrated database retrieval system