KEGG   Rahnella aquatilis HX2: Q7S_06920Help
Entry
Q7S_06920         CDS       T01850                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00260  Glycine, serine and threonine metabolism
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01120  Microbial metabolism in diverse environments
raa01130  Biosynthesis of antibiotics
raa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:raa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7S_06920
Enzymes [BR:raa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Q7S_06920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Bclx_interact
Motif
Other DBs
NCBI-ProteinID: AFE57628
UniProt: H8NRQ8
Position
complement(1517102..1518115)
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSEAMRQAMARAEVGDDVYGDDPTVNALQDMAAKLCGKDAALFLPTGTQ
ANLVALLTHCQRGEEYIVGQKAHNYMYEAGGAAVLGSIQPQPLDMDADGSIPLDKIAAAI
KPDDIHFARTRLLSLENTHSGKVLPLDYLQKAFAFTREKGLALHIDGARIMNAAVALNVE
LREITQYCDTLTICLSKGLGAPIGSLLVGSKEYIQRANRWRKMTGGGMRQSGILAAAAIY
ALENNVSRLQDDHDNAQWLAQELRKIGVEIAEPGAQTNVLYIKQSAELAAKMGPWMQERG
VIISAGPVTRVLTHINISREDLQKVVALWQEFLHQHA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgatttacgcagtgataccgtaacccgccccagtgaagctatgcgtcaggccatg
gcccgcgctgaagtcggcgatgatgtctacggcgatgacccaacggtaaatgctttacag
gacatggcggcaaagttgtgtggcaaagacgcggcgctgtttttaccaaccggtacgcag
gccaatctggtggcgttgctgacgcactgccagcgtggcgaagaatatattgttggtcag
aaagctcacaattatatgtatgaagcaggtggagccgcggtgctcggcagtatccagcct
cagccgctggacatggatgctgacggttctatcccgctggataagatcgcggcagccatc
aagcccgatgatatccattttgcccggacccgtctgctgagcctggaaaacacccacagt
ggcaaagtgcttccgctggattatctgcaaaaggcgttcgccttcacccgtgaaaaaggg
ctggcactgcacattgatggcgcgcgtatcatgaatgcggcagtggcactgaacgtggaa
ttacgtgagatcactcagtattgcgacacgctgaccatctgcctgtcgaaaggtctgggc
gcaccgattggttcccttctggtcggcagcaaagagtacatccagcgtgctaaccgctgg
cgcaaaatgaccggtggcggtatgcgccagtccggtattctggccgcagcagcaatttac
gcgctggaaaataacgtttcacgtctgcaagatgaccacgacaatgcacagtggctggca
caggaactgcgcaaaatcggcgtagaaatcgctgaacccggtgcccaaaccaatgtgctg
tacattaaacaaagcgcggaactggcagccaaaatggggccgtggatgcaggagcgcggt
gtgatcatcagtgcggggccggtcacacgcgtgctgacgcatatcaatatcagtcgtgaa
gatctgcaaaaagtcgtggcgctgtggcaggaattcctgcatcagcacgcctga

DBGET integrated database retrieval system