KEGG   Rahnella aquatilis HX2: Q7S_13045Help
Entry
Q7S_13045         CDS       T01850                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01130  Biosynthesis of antibiotics
raa01230  Biosynthesis of amino acids
Module
raa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q7S_13045
Enzymes [BR:raa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Q7S_13045
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Q7S_13045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI Adenine_deam_C
Motif
Other DBs
NCBI-ProteinID: AFE58832
UniProt: H8NP42
Position
2884450..2885814
Genome map
AA seq 454 aa AA seqDB search
MQQETVLHKIVRDKEIWVAARKDQQPLASFQNDITQSQRSFYHALQGARTAFILECKQAS
PSKGKIRDNFDPVEIASVYKDYASAISVLTDEKYFQGSFDFLPLVSKTVTQPVLCKDFII
DPYQIHLARFYQADAILLMLSVLDDDQYVQLAAVAHSLNMGVLTEASNEEELDRAVKLKA
KVVGINNRDLRDLSIDLNRTRELAPRVPHGVTVISESGINTYGQIRELSRFANGFLIGSA
LMSEQDLSSAVRRVLLGENKVCGLTRAQDAKAAHEAGAIYGGLIFVEASPRFVTQTQAKE
VQNGAPLKYVGVFRDEEITTVAQTAQTLNLAAVQLHGDEDQVYIDALRTALPQTVQIWKA
LSVKETLPARDLNHVDRYVLDNGKGGTGHRFDWSKLAGQDLSNTLLAGGLSADNCVEAAQ
LGCAGLDFNSGVESEPGIKDAGKINAVFQTLRAY
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggaaaccgtgctccacaaaattgttcgcgataaagaaatttgggtcgcggca
cgtaaagatcagcaaccgctggccagctttcagaacgacataactcagagccagcgcagt
ttctaccatgccctgcaaggggcaagaaccgcctttattctggagtgcaaacaagcgtct
ccgtcgaaaggcaagatccgcgataactttgatccggtagaaatcgccagcgtttataaa
gactacgcttccgccatctccgtattaacggacgaaaaatacttccagggcagttttgat
tttctgccgctggtgagcaaaaccgtcacacagcctgtgctgtgcaaagattttattatc
gacccgtatcagatccatctggcccgtttctatcaggctgatgcgattttgctgatgctg
tcagtgctcgatgacgatcagtacgttcagctcgccgcggttgctcacagccttaacatg
ggggtgctgacggaggccagtaatgaagaagaactggatcgcgccgttaaactgaaagcc
aaagtcgtcggtatcaataaccgcgatttgcgcgatttgtctatcgacctgaaccgcacc
cgtgagctggcaccgcgcgtaccgcatggcgtcacggtcatcagtgaatcaggtattaat
acttacggacaaatccgtgaactgagccgcttcgccaatggcttcctgatcggcagtgcg
ctgatgtcggaacaagacctgagcagtgccgttcgtcgcgtgctgctcggtgaaaacaag
gtctgtggcctgacccgcgctcaggatgccaaagccgcgcacgaagctggtgctatttat
ggcgggctgatttttgttgaagcctcaccgcgtttcgtgacacagacgcaggcgaaagaa
gtgcagaacggcgcaccgctgaagtatgtcggcgtgttccgcgatgaagaaatcaccaca
gtggcccagacggctcagacattaaacctggccgccgtgcagcttcatggcgacgaagat
caggtttatatcgatgccctgcgcacagccttgccgcaaacggttcagatctggaaagcg
ctgagcgtcaaagaaacattgccagcgcgcgacctgaatcacgtggatcgttacgtcctg
gacaacggcaaagggggcacgggtcaccggttcgactggagcaaactggccggtcaggat
ttgagcaacaccttactcgccggtggactgagcgcagataactgcgtcgaagccgcacaa
ctcggttgcgcaggcctggatttcaactcaggtgttgaaagcgagccgggcatcaaggat
gccgggaaaattaatgccgtattccagacattgcgggcgtattaa

DBGET integrated database retrieval system