KEGG   Rahnella aquatilis HX2: Q7S_13050Help
Entry
Q7S_13050         CDS       T01850                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00260  Glycine, serine and threonine metabolism
raa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01130  Biosynthesis of antibiotics
raa01230  Biosynthesis of amino acids
Module
raa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7S_13050
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q7S_13050
Enzymes [BR:raa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Q7S_13050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Mic1
Motif
Other DBs
NCBI-ProteinID: AFE58833
UniProt: H8NUT9
Position
2885859..2887049
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQYVPQILMPALAQLEEAFVSAQRDPEFQAEFIDLLKNYAGRPTALTL
CKNLTAGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
EKAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQMQEREGCLPDAVIACVGGGSNAIGMF
ADFIDDTSVKLIGVEPGGLGIETGQHGAPLKHGHVGIYFGMKAPMMQTSEGQIEESYSIS
AGLDFPSVGPQHAFLNSIGRAEYVSITDDEALDAFKELSRHEGIIPALESSHALAYALKL
IKETPEKEQILVVNLSGRGDKDIFTVHDILTARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactttacttaatccctactttggcgaatttggcggccagtatgtcccgcaaattctg
atgcctgcgctggctcagctggaagaagcttttgtcagcgcacagcgcgaccctgagttt
caggccgaattcattgatttactgaaaaactacgcaggccgcccgaccgccctgacgttg
tgtaaaaacctgaccgcaggcaccaaaaccaagctgtaccttaagcgtgaagatttgctg
cacggcggcgcgcacaaaactaaccaggtgttgggtcaggcattactggccaaacgcatg
ggcaaaactgaaatcatcgccgaaaccggcgcgggtcagcacggcgtggcatcggcactg
gcctgtgcgctgctcggcctgaaatgccgcatttatatgggcgcaaaagacattgagcgt
cagtcgccaaacgtgttccgtatgcgtctgatgggggctgaagtgattccggtacatagc
ggttcttccacgctgaaagatgcctgtaatgaggcgctgcgtgactggtccggcagctat
gaaaaagcccactacatgctgggcacggcagcaggcccgcatccgtatccgaccatcgtg
cgtgaattccagcgtatgatcggcgaagaaaccaaagcgcagatgcaggaacgcgaaggc
tgcctgccggatgcggtgattgcctgcgtcggcggcggctccaatgcgatcggtatgttt
gcggatttcatcgacgacaccagcgtgaagctgattggcgttgaaccgggtggtctgggc
attgaaaccggacaacacggcgcgccgctcaaacacggtcacgtcggcatttacttcggc
atgaaagcaccgatgatgcagacgtctgagggtcagattgaagaatcctactcgatttca
gccggtctggatttcccgtccgtcggcccgcaacacgcttttctcaacagcattggccgt
gcagaatatgtgtcgattaccgatgatgaagcgctggatgcctttaaagaattgtcccgc
catgaagggattattcctgcactggaatcctctcatgcgctggcttacgcgctgaaactg
atcaaggaaacaccagagaaagaacaaatcctggtcgtgaatttgtcaggtcgcggcgac
aaagacattttcaccgtacacgacatcctgactgcccggggagagatttaa

DBGET integrated database retrieval system