KEGG   Rahnella aquatilis HX2: Q7S_19185Help
Entry
Q7S_19185         CDS       T01850                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
raa  Rahnella aquatilis HX2
Brite
KEGG Orthology (KO) [BR:raa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Q7S_19185 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AFE60046
UniProt: H8NYZ1
Position
4189959..4190336
Genome map
AA seq 125 aa AA seqDB search
MLNSPRVCVQVQSFYVESQSIPEEERFVFAYTITIRNLGRFNVQLLRRYWLITNSNGRQT
EVQGEGVIGEQPLILPGNEFYYTSGAILETPLGTMEGHYEMVAQDGETFRVPVPVFRLAI
PTLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcttaattcgccccgcgtttgtgttcaggtgcaaagtttctacgttgagtcacagtcg
atacccgaagaagaacgttttgtcttcgcttacaccatcaccatccgcaatctggggcgt
tttaatgtgcaactgcttcgccgttactggctgataaccaacagtaatggtcgccagact
gaagtccagggtgaaggggtcatcggtgaacaaccgctgatcctgccaggcaatgaattt
tactataccagcggcgctattttagaaacgccactgggcacgatggaaggccattatgaa
atggtcgcacaagacggtgaaaccttccgtgtgcctgttccggtcttccgcctcgccatc
cctacgctgataaattaa

DBGET integrated database retrieval system