KEGG   Rahnella aquatilis HX2: Q7S_19460Help
Entry
Q7S_19460         CDS       T01850                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00240  Pyrimidine metabolism
raa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Q7S_19460 (deoA)
Enzymes [BR:raa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Q7S_19460 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AFE60101
UniProt: H8NZ46
Position
complement(4258913..4260241)
Genome map
AA seq 442 aa AA seqDB search
MFLAQEIIRKKRDGQPLSDEEIRFFVNGIRDSQVSEGQIAALAMTIYFNDMTMNERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDSRFRSIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYQLSEDLAQAIVDVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAKDDADARSQL
QAVLDNGKAAEVFGRMIAAQKGPTDFIENYDRYLQQATLSKPVYAEGNGIVSAMDTRALG
MAVVSLGGGRRRASDAIDYSVGLTHMAQLGQQVDTRQPLAMIHANSEAAWQQAAQEVRAA
IVLSDKAPESTSVVYRRIGGNA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgacggtcagcctttaagcgatgaa
gaaattcgtttctttgttaatggtattcgcgacagtcaggtttcagaaggccagattgcc
gcgctggcaatgactatctatttcaatgatatgaccatgaatgagcgtgtgtcgctgacc
atggcaatgcgcgactccggtaccgtactggactggaaatcgctcaacctcaacggcccg
atcgttgataaacattcgaccggcggtgtgggtgacgtgacgtccctgatgctggggccg
atggtagcggcatgcggcggttatgtgccgatgatttccggccgcggcctcggtcatacc
ggcggtacgctggataaacttgaagccatcccgggcttcgatattttcccggatgacagc
cgttttcgcagcatcattcaggatgtcggcgtggcaattatcggccagaccagctcgctg
gctccggcggataagcgtttctatgcgacacgtgatatcaccgcaactgtcgattctatc
ccgctgatcactgcttcgattctcgccaaaaaactggccgaagggctggatgcgttagtg
atggacgtcaaagtcggctccggggccttcatgccgacttaccagctatccgaagatctg
gcgcaggcgattgtcgatgtggccaatggcgcaggttgtaaaaccacggcgctgctgacc
gacatgaatcaggtgctggcatccagcgcagggaatgcggtggaagtgcgcgaagccgtg
cgcttcctgacgggtgaataccggaatccgcgtctgctggaagtgacaatggcgctctgt
gttgaaatgctgctgtccggcgggctggcaaaagatgacgccgacgcccgcagtcagttg
caggccgtgctggataacggcaaagccgcagaagtctttggccgcatgattgccgcccag
aaaggtccaaccgatttcatcgagaattacgatcgttatctgcaacaggccacgctgagc
aaaccggtttacgccgaaggcaacgggattgtcagcgcgatggacacccgtgcgctgggc
atggccgtcgtttcactgggtggcggacgtcgccgcgccagcgatgctatcgactacagc
gtcggtctgacccatatggcgcagcttggccagcaagtggatacccgtcagccactggcg
atgatccacgcgaacagtgaagcggcctggcagcaggcggcgcaggaagtgcgtgcggcc
attgtcctgagcgacaaagcgccggaaagcacgtcggtggtttaccgccggatcggtggt
aacgcttga

DBGET integrated database retrieval system