KEGG   Rahnella aquatilis HX2: Q7S_20905Help
Entry
Q7S_20905         CDS       T01850                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00630  Glyoxylate and dicarboxylate metabolism
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01120  Microbial metabolism in diverse environments
raa01200  Carbon metabolism
Module
raa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Q7S_20905
Enzymes [BR:raa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Q7S_20905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFE60390
UniProt: H8NQR5
Position
complement(4574306..4575628)
Genome map
AA seq 440 aa AA seqDB search
MKTNRTQQIQQLEETWSQPRWKNITRPYTAAEVISLRGSVNPECTLAQHGAARLWNLLHG
ASRKGYVNCLGALTGGQALQQAKAGIEAIYLSGWQVAADANTASSMYPDQSLYPVNSVPE
VVARINNTFRRADQIQWANNIEPGQPGYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLAAVKKCGHMGGKVLVPTQEAVQKLISARLAADVLGVPTLLVARTDADAAD
LLTSDCDPYDSQFITGERTHEGFYRTNAGIEQAISRGLAYAPYADVVWCETSTPDLKLAQ
RFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDKTIASFQDQLAAMGYQYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVDKVQEPEFAAIDRGYTFASHQQEVGTGYFDKVTTIIQGGR
SSVTALTGSTEEQQFSPTSH
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaccgtactcagcaaattcagcagcttgaagaaacgtggagccaaccacgc
tggaaaaatatcacccgaccttacacggcggcagaagtgatcagcctgcggggttcagtc
aatccggagtgtacgctggctcagcacggagctgcccgcctgtggaatttactccacggc
gcatcgcgtaaagggtatgtgaattgcctcggcgcgctgacaggtggccaggccttacaa
caggcaaaagcgggtatcgaagccatttatctctcgggatggcaagttgccgcggatgcc
aatacggcttccagtatgtatcccgaccagtctttgtatcctgtgaattcggtgcctgaa
gttgtggcgcggattaacaacacttttcgtcgcgctgatcagatccagtgggccaataac
attgagcccgggcagcctggctataccgactatttcctgccgattgtggcggacgctgaa
gccggttttggtggcgtactcaatgcctttgaactgatgaaatccatgattgaagccggt
gctgccgccgttcattttgaagatcagcttgctgcggtgaagaagtgcgggcatatgggc
ggcaaagttctggtgccgacacaggaagccgtacagaagctgatttccgcgcgtcttgcc
gccgatgttcttggtgtgccgacgttgttggtggcacgtaccgatgccgatgcggcagat
ttactgacgtcggactgcgacccgtatgacagccagtttattaccggcgaaagaacacat
gaaggtttctaccggacgaacgccggtattgagcaggccatcagtcgcggtctggcgtac
gcaccttatgccgacgtagtgtggtgcgagacatcgacgcctgatctgaaactggctcag
cgttttgctgaggccatccacgctaaattcccgggcaaattgctggcctataactgttcg
ccatcgtttaactggaagaagaatctcgacgataaaaccatcgccagtttccaggaccag
ttggccgcgatgggttaccagtatcagttcattacgctggcgggcattcacagcatgtgg
ttcaacatgttcgatcttgcccatgcttatgcacagggcgaggggatgaagcactacgtg
gataaagtgcaggagccggaatttgcagccatagatcgcggctatacctttgcttctcat
cagcaggaagtcggaaccggctatttcgataaagtcactaccattattcagggcggtcgc
tcctcggttaccgcactcaccggctctaccgaagaacagcagttttctccgacgtcacac
tga

DBGET integrated database retrieval system