KEGG   Rahnella aquatilis HX2: Q7S_22896Help
Entry
Q7S_22896         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LVIVD DUF397
Motif
Other DBs
NCBI-ProteinID: AFE60743
UniProt: H8NZQ3
Position
PRA1:32435..33682
Genome map
AA seq 415 aa AA seqDB search
MTTQSLPTPEYSRNMRLIGHSDQGGKPDGVQVMVHRGYAYIGHMVSQGFSIVDVRDAKNP
RPAGFVAAPPGTWNVHLQAHDDLLLVINARDLFADVRFADEKVYYTRSVSETVQGTQQRG
WSAGVRIFDISVPDQPKEISFLALEGIGVHRIWYVGGRWAYVSALIDGYSDYIFLTIDLA
DLRNPQVAGRWWLPGMHTAGGEKPDWPEGKRYALHHAIISGDTAYASWRDGGLTLLDIKD
RSAPQLISHRNWSPPFGGGTHTALPLPDRDLLVVLDEAVLDNQEDGEKLIWLFDVREPSN
PVSISTFPQPEERDYVSKGAHFGPHNLHENRPGSFISSTLIFATYQNAGVRAYDISNPYQ
PKETGALVPAAPVTMMDKRPGRPQVIQSCDVFVDAQGIIYSTDYNGGLSIIEYLG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcaatctctcccgaccccggaatacagtcgtaatatgcgactgatcggccac
agcgatcagggcggaaaacctgacggcgtacaggtaatggtccatcgtggctacgcgtat
atcggccacatggtgtcgcagggtttctccattgtggatgtgcgtgatgccaaaaatcct
cgccctgccggttttgtggcggcaccgccgggcacctggaatgtgcatctgcaggcgcac
gacgatttactgctggtgatcaacgcccgtgatttgttcgcagatgtccgcttcgccgat
gaaaaagtctattacacccgctccgtcagcgagacggttcagggtacgcagcagcgtggc
tggagcgccggtgtgcgtatctttgatatttcggtgcccgatcaaccaaaagaaatcagc
tttctcgcgctggaaggtatcggcgtacatcgcatctggtatgtcggcgggcgctgggcg
tacgtttcagccctgattgatggctacagcgattatattttcctgacgattgatctggcc
gacctgcgcaatccgcaggtcgccggacgctggtggctgccggggatgcataccgcaggc
ggtgaaaagccggactggccggaaggtaaacgttatgcgctgcaccatgccattatcagc
ggggatacggcatatgccagctggcgtgacggcggcctgacgttgctggatatcaaagac
cgcagcgcgccacaactgatttctcaccgcaactggagtccgccatttggcggcggcacg
cataccgcgctgccgttgccggaccgggatttgctggtcgtgctcgacgaggcagtgctg
gataatcaggaagatggcgagaagttgatctggctgtttgacgtgcgcgagccgtcgaat
ccggtgagtatttcgacctttccgcagccggaggaacgggattacgtcagcaaaggtgcg
catttcgggccgcacaatttgcatgaaaaccggccgggcagctttatcagttcaacgctg
attttcgcgacctaccagaatgcgggtgtacgtgcgtacgacatcagcaatccgtatcag
ccgaaagaaaccggtgcgctggtgcccgctgcgcccgttaccatgatggataaacgtcct
ggcaggccgcaggtgattcagtcctgcgacgtgtttgtcgatgcgcagggaattatctac
agcaccgactataacggcggattatccattatcgaatatctcggctga

DBGET integrated database retrieval system