KEGG   Rahnella aquatilis HX2: Q7S_22911Help
Entry
Q7S_22911         CDS       T01850                                 

Definition
(GenBank) lipoprotein
  KO
K05979  2-phosphosulfolactate phosphatase [EC:3.1.3.71]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00680  Methane metabolism
raa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:raa00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Q7S_22911
Enzymes [BR:raa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.71  2-phosphosulfolactate phosphatase
     Q7S_22911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-ph_phosp Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFE60744
UniProt: H8NZQ4
Position
PRA1:34750..35472
Genome map
AA seq 240 aa AA seqDB search
MTDFSQADFDVRLEWGAQAVEHLAADADCIVIIDVMSFSTCVSIATARGGTVFPYPWKDA
SAQQYAAERNAQCAQFDRRFQGPGFTLSPCSLQEMVSGTRLVLPSPNGSALTFQAKTHNA
AIFTACLRNLTATARACEQYPRILVIPAGEKWPDNSLRPALEDLVAAGGLISRLRNRQLS
AEARAAQTVYQNLTLAELADCGSARELTRRGFAADVALCLQEDVSDFACQLQDDFFTSAD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttctcacaagctgattttgacgtgcgtctggaatggggcgcgcaggcggtg
gagcatctggcggcagatgccgattgcatcgtgattattgatgtcatgtcgttttctacc
tgcgtgagtatcgccaccgcgcgcggcggaacggtgtttccgtatccgtggaaggatgcc
agcgcgcagcaatatgccgctgagcggaatgcgcagtgcgcgcaatttgaccggcgtttt
caggggccggggttcaccctttcgccctgctctctgcaggaaatggttagcggaacgcgg
ctggtattgccttcgccgaacggatcggcgctgacctttcaagccaaaacacacaatgcg
gcgattttcaccgcctgcttgcgcaatctcaccgccacggcgcgtgcctgtgaacagtat
ccgcgcattctggtgatccccgccggtgaaaaatggccggacaatagtcttcgcccggcg
cttgaagatctggtcgctgcggggggattgatttcacggctgcgcaatcgtcagttgtca
gcagaagcccgcgcggcgcagacggtttatcaaaacctgacgcttgcagaacttgcagat
tgcggctcagcacgcgaactcacccgacgcggttttgctgctgatgttgcgctgtgtctg
caggaagatgtcagtgatttcgcttgtcagttgcaggatgattttttcacgtcggccgac
taa

DBGET integrated database retrieval system