KEGG   Rahnella aquatilis HX2: Q7S_22951Help
Entry
Q7S_22951         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like
Motif
Other DBs
NCBI-ProteinID: AFE60752
UniProt: H8NZR2
Position
PRA1:complement(46854..47534)
Genome map
AA seq 226 aa AA seqDB search
MKILMVLTSHDKLGNTGRKTGFWLEELAAPYYAFKDAGAEIVLASPAGGQPPLDPKSNEP
DFQTQQTHRFEADEQAKAQLASTVRLDSISQADFDAVFYPGGHGPLWDLAEDTTSIELIQ
SFQAAGKHVALVCHAPGVLRHVKDAQGNPLVQGKKVTGFTNSEEAAVELTDVVPFLVEDE
LKALGGVYSKGADWGSYVVQDGLLITGQNPGSSAEAAELLVQQLSK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattctgatggttctgacttcgcacgacaaactgggcaacacgggccgtaaaacg
ggtttctggctggaagagctggcagcaccgtattacgcttttaaagatgcaggcgcagaa
attgtgctggcgtccccggctggcggccagccaccgctggatccgaaaagtaacgaaccg
gatttccagacgcagcaaacccaccgctttgaagccgatgaacaggcgaaggcacaactg
gcctccaccgtgcgtctggacagcatttctcaggctgattttgatgcagtcttttatccg
ggcggtcatggcccgttgtgggatctggcggaagatacaacctccattgagctgatccag
tcattccaggctgcgggtaaacacgttgcgctggtgtgtcatgcgcctggcgtgctgcgt
catgtgaaagatgcacaaggtaatccgctggtacagggcaaaaaagtcaccggtttcacc
aacagcgaagaagcagcggttgagctgaccgacgtagtgcctttcctggtggaagatgaa
ctgaaagcactgggtggtgtgtattcgaaaggcgctgactggggttcttacgtagtgcag
gatggtctgctgatcaccgggcagaatccgggttcttccgcagaagcggcagaattgtta
gttcagcaactgagcaaataa

DBGET integrated database retrieval system