KEGG   Rahnella aquatilis HX2: Q7S_22966Help
Entry
Q7S_22966         CDS       T01850                                 

Definition
(GenBank) heat shock protein DnaJ domain protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ SYF2 Vwaint
Motif
Other DBs
NCBI-ProteinID: AFE60755
UniProt: H8NZR5
Position
PRA1:50151..50723
Genome map
AA seq 190 aa AA seqDB search
MAIWSVLGIEATQDISAIKRAYARQLKNTRPDQDPEAYQRLREAFESARRGDYVWNTSDA
VTYSSPLLPMTDDALVRRTQVHHLVSDTVSLLLENEQAGVALLKVCLSEELLQNLQLREM
FSQQLAWDLAEREGLTRPVLVNVAALMGWEIDHYQPVGISLCQLDALHQQIENTAGSRCR
DDSGTRWGED
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctggtcagttctggggatagaagccacgcaggacatcagcgcgatcaagcgg
gcctatgcgcggcagctcaaaaacacgcgacccgatcaggatcccgaagcgtatcagcgt
ctgcgggaagcgtttgaatcagcccggcgcggcgattatgtgtggaataccagtgacgct
gtcacttattcatctccccttttgccgatgactgatgacgcattagtccgccggacgcag
gtccaccatctggtatccgataccgtcagcctgctgctggaaaatgaacaggctggcgtg
gcgttgctgaaagtttgtctgtcagaagaattgctgcaaaatcttcagttgcgcgaaatg
ttcagtcagcagctggcgtgggatctggcggagcgtgaaggactgacccgcccggtgctg
gtgaacgttgccgcgctgatgggatgggaaattgaccattatcagcccgtcgggatttcg
ctttgtcagcttgatgcgttgcatcagcaaattgaaaatactgccggaagtcgttgccgg
gatgattccggtacacgatggggtgaagactga

DBGET integrated database retrieval system