KEGG   Rahnella aquatilis HX2: Q7S_22981Help
Entry
Q7S_22981         CDS       T01850                                 

Definition
(GenBank) proline/glycine betaine transporter
  KO
K03762  MFS transporter, MHS family, proline/betaine transporter
Organism
raa  Rahnella aquatilis HX2
Brite
KEGG Orthology (KO) [BR:raa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:raa02000]
    Q7S_22981
Transporters [BR:raa02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Metabolite:H+ symporter (MHS) family [TC:2.A.1.6]
    Q7S_22981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 Osmo_CC MerR-DNA-bind TRI12 DUF5469 Prefoldin_2
Motif
Other DBs
NCBI-ProteinID: AFE60758
UniProt: H8NZR8
Position
PRA1:complement(53732..55234)
Genome map
AA seq 500 aa AA seqDB search
MRLRKKRVKPMQINDITIIDDTKLKKAITAAALGNAMEWFDFGVYGFVAFALGQVFFPGA
DPGIQMIAALATFSVPFLVRPLGGLFFGALGDKFGRQKVLSVTIIIMSVSTFCIGLIPGY
NSIGIWAPILLLLAKLAQGFSVGGEYTGAAIFVAEYSPDRKRGFLGSWLDFGSIAGFILG
AGVVVLISSIVGEANFLEWGWRIPFFIAAPLGLIGIYLRHALEETPTFQQHVDKIDSDAR
KDIAEPPRVSFREILTKQWRPLIICVGMVIATNVTYYMLLTYMPSYLSHSLHYSEDHGVL
IIIAIMVGMLFVQPFMGMLSDRFGRKPFVIIGSIGLFILAIPCFILINSDVIGLIFLGLL
ILAVLLNCFIGVMASTLPAMFPTHIRYSALAIAFNISVLIAGLTPTIAAWLVETTNNLYM
PAYYLMVVAMIGLVTGIFMKETANRPLKGATPAASDRAEAREILQEHHDNIEQKIEDIDA
QIVELEAKRKNLIAQHPDIN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagattaagaaaaaaacgtgtgaaacctatgcaaatcaatgacattactatcattgac
gacaccaaactgaaaaaagccattaccgccgcagcactgggcaatgcgatggaatggttt
gatttcggtgtgtatggatttgtggcctttgctttagggcaggtgtttttcccgggtgca
gacccgggtattcaaatgattgccgccctggcaaccttttccgtaccgttccttgtcagg
cctctgggcggcctgttcttcggtgcgcttggcgacaaatttggtcgccagaaagtcctt
tccgtcaccatcatcatcatgtccgtcagcaccttctgtatcgggctgatacccggttat
aactccatcggtatctgggcgcccattttgctgttactggcaaaattagcgcagggtttc
tcggtgggtggcgaatataccggtgcagcgattttcgttgcggaatattctcctgacagg
aaacgcggcttcctcggtagctggctggatttcggttccatcgccggttttattctcggt
gcgggcgtcgtggtattgatttccagcattgtgggtgaggcgaacttcctcgaatggggc
tggcgtattccgttcttcattgctgcgccgctgggcctgatcggtatttatctgcgtcat
gcgctggaagaaaccccgacattccagcagcacgtggataaaatcgacagtgatgcacgc
aaagacatcgctgaaccgccaagagtctcgttccgtgaaatcctgaccaagcaatggcgg
cctctgattatctgtgtcggcatggtgattgccacaaacgtcacctactacatgctgctg
acctacatgccgagctatctgtcccacagcctgcattactctgaagatcacggtgtgctg
atcatcatcgccatcatggtcggtatgctgtttgtacagccattcatggggatgctgagc
gaccgctttggccgtaagcctttcgtgatcatcggcagcatcggcctgttcattctggct
atcccgtgcttcattctgattaacagtgatgtgataggcctgattttcttaggtctgctg
atcctcgcggtgctactgaactgcttcatcggtgtgatggcgtcaacgttaccggcaatg
ttcccgacgcatatccgttacagcgcgctggcgattgctttcaacatttcagtactgatt
gcgggtctgacgcccacgatcgcggcgtggctggtagaaacaaccaataacctgtacatg
cccgcgtattacctgatggtggtggcgatgattggtctggtgaccggtatctttatgaaa
gaaaccgccaaccgtccgctgaaaggcgccacaccggcggcctcagaccgtgcggaagcg
cgtgaaatcctccaggaacatcacgataacatcgaacagaaaattgaagatattgatgcg
cagattgttgaacttgaagcaaaaagaaaaaatctgattgctcagcatcctgatatcaac
tga

DBGET integrated database retrieval system