KEGG   Rahnella aquatilis HX2: Q7S_22986Help
Entry
Q7S_22986         CDS       T01850                                 

Definition
(GenBank) Oligogalacturonide lyase
  KO
K01730  oligogalacturonide lyase [EC:4.2.2.6]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q7S_22986
Enzymes [BR:raa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.6  oligogalacturonide lyase
     Q7S_22986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectate_lyase22 PD40 DPPIV_N DUF5050
Motif
Other DBs
NCBI-ProteinID: AFE60759
UniProt: H8NZR9
Position
PRA1:55527..56708
Genome map
AA seq 393 aa AA seqDB search
MAKGSQIQFNFHTVQDPQTGARVTRLTPPDVLCHRNYFYQKCFTRDGNKLLFAGEFDGNR
NYYLLDLKTQNAVQLTEGKGDNTFGGFLSPDDQYLYYVKNERSLQRVKLADFSEHTVYQV
PEEWVGYGTWVANSECTRLVGIEISREDWTPLSDWKIFQAFYHSNPHCRLLRVDLLSGKS
RVIHEKNEWLGHPIYRPFDDNTVAFCHEGPHDLVDARMWLVNEDGSNVRKVKEHAPGESC
THEFWVPDGSALMYVSYLKGQHDRHIRRFDPQTGEDVCLMTMPACSHLMSNENGTLLVGD
GSGTPVDVKDTASHTIENDPWLYIFDAKTRQHAPLAAHNSSWQVLDGDRQGTHPHPSFSP
DDRHVLFTTDYEGLPALYLAEIPDALLSSLRKD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggttctcagattcaatttaatttccataccgttcaggaccctcagaccggt
gcgcgggtaacccgtttaacgccgcccgatgtgttgtgtcatcgcaattatttctatcag
aaatgctttacccgtgatggcaataaactgttgtttgccggtgagtttgacggcaaccgc
aactattacctgctggatttgaaaacacagaatgcggtgcaactgacggaaggcaaaggc
gataacacttttggcggtttcctctctccggacgatcagtatctttactacgtcaaaaat
gaacgtagcctgcagcgcgtaaaactggctgattttagtgagcacaccgtgtatcaggtg
ccggaagaatgggttggctacggcacctgggtggccaacagcgaatgcacccgtctggtg
ggtatcgagatcagtcgtgaggactggacgcccctgtcagactggaaaatcttccaggcg
ttttatcacagcaatccgcactgccgtctgttgcgcgtcgatttactcagcgggaaatcc
cgtgtgatccacgagaaaaacgaatggctcggacacccgatttatcgcccgtttgatgac
aacaccgtcgctttctgccacgaaggccctcacgatctggttgatgcacgcatgtggctg
gtgaatgaagacggcagcaatgtgcgtaaagtgaaagagcatgcgccaggcgaaagctgc
acacatgaattctgggtaccggacggttctgcgctgatgtatgtgtcttatctgaaaggc
cagcatgaccgccacatccgccggttcgatccgcaaactggtgaagatgtctgtctgatg
actatgccggcctgttcgcatctgatgagcaacgagaatggcacgctgctggtcggtgac
ggttccggtacgccggtagatgtgaaagatactgccagccatacgattgaaaacgatccg
tggttgtatattttcgatgccaaaacccgtcagcatgctcctctggccgcgcataacagt
tcatggcaagtgcttgatggcgaccggcaggggacgcatccgcacccatctttctcgccc
gatgaccgtcacgtgcttttcaccaccgattacgaaggcttaccggcactgtatctggcg
gaaatcccggatgccctcctcagttcattacgcaaggactaa

DBGET integrated database retrieval system