KEGG   Rahnella aquatilis HX2: Q7S_22991Help
Entry
Q7S_22991         CDS       T01850                                 

Definition
(GenBank) cupin 2 domain-containing protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_3 AraC_binding Cupin_1 Cupin_7 DMSP_lyase
Motif
Other DBs
NCBI-ProteinID: AFE60760
UniProt: H8NZS0
Position
PRA1:56712..57032
Genome map
AA seq 106 aa AA seqDB search
MFTFKKDIPLQDLGDGVSRRVLAHDGTMMAVEVYFEEGAIGPMHNHVHEQLTYVLSGRFK
FTIGEETREVSAGDTLYKKPYIMHGCVCLEKGVLLDTFTPQRQDFL
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgtttacgtttaaaaaagatattcccttacaggatctgggtgacggtgtgagccgtcgc
gttctggcgcatgacggcaccatgatggccgttgaagtgtattttgaagaaggcgccatt
ggaccgatgcataaccacgtgcatgaacagctgacatatgtgttgtccggtcgctttaaa
ttcacgatcggtgaagaaacccgtgaagtaagcgcaggcgatacgctgtataaaaaaccg
tacatcatgcacggctgcgtctgtctggaaaaaggtgtgttgctcgacacgttcacgccg
caacgacaagattttttataa

DBGET integrated database retrieval system