KEGG   Rahnella aquatilis HX2: Q7S_23006Help
Entry
Q7S_23006         CDS       T01850                                 

Definition
(GenBank) AraC family transcriptional regulator
  KO
K05804  AraC family transcriptional regulator, mar-sox-rob regulon activator
Organism
raa  Rahnella aquatilis HX2
Module
raa_M00647  Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
raa_M00767  Multidrug resistance, efflux pump OqxAB
Brite
KEGG Orthology (KO) [BR:raa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:raa03000]
    Q7S_23006
   03036 Chromosome and associated proteins [BR:raa03036]
    Q7S_23006
Transcription factors [BR:raa03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    Q7S_23006
Chromosome and associated proteins [BR:raa03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Q7S_23006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC HTH_3 HTH_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: AFE60763
UniProt: H8NZS3
Position
PRA1:complement(58965..59321)
Genome map
AA seq 118 aa AA seqDB search
MRTEDFIHDLIEWIDHNLEERLDIKTVAKRAGYSRWYLQRMFKEHTGLPMGEYIREKKLK
KSADMLASSGEPIVSVAISLGFDSQQSFTRSFKRQFGQTPGDWRRGLNLATECQGCLH
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgaggatttcattcacgacctgatcgagtggatcgatcacaatctggaagaa
cgtctggatattaaaactgttgccaaacgggcagggtattcccgctggtatctgcagcgt
atgtttaaagagcacaccggcttgccgatgggtgaatacattcgtgagaaaaaactgaag
aaatctgccgatatgctggccagtagtggcgaacctattgtcagcgttgcgatttctctg
ggcttcgactcacagcaatctttcacccgcagtttcaaacgccagtttggtcagactccg
ggcgactggcgtcgtggtctgaatctggcaacggaatgtcagggctgcctgcactaa

DBGET integrated database retrieval system