KEGG   Rahnella aquatilis HX2: Q7S_23016Help
Entry
Q7S_23016         CDS       T01850                                 

Definition
(GenBank) transporter, hydrophobe/amphiphile efflux-1 (HAE1) family protein
  KO
K19585  multidrug efflux pump
Organism
raa  Rahnella aquatilis HX2
Module
raa_M00767  Multidrug resistance, efflux pump OqxAB
Brite
KEGG Orthology (KO) [BR:raa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:raa02000]
    Q7S_23016
Transporters [BR:raa02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Q7S_23016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF DUF4149 Patched
Motif
Other DBs
NCBI-ProteinID: AFE60765
UniProt: H8NZS5
Position
PRA1:60918..64070
Genome map
AA seq 1050 aa AA seqDB search
MDFSRFFIDRPIFAAVLSILILVTGAIAIPLLPVSEYPNVVPPSVQVRAEYPGANPKVIA
ETVATPLEEAINGVENMVYMKSVAGSDGVLVTTVTFRPGTDPDQAQVQVQNRVAQAEARL
PEDVRRQGVTTQKQSPTLTLVVHLVSPSGKYDSLYLSNYATLKVKDELARLPGVGQIQIF
GAGEYAMRVWLDPNKVAARGLTASDIVKAMQEQNVQVSAGQLGAEPMPKDSDYLLSINAQ
GRLKDEDEFGKIILKSGDNGEIVRLRDVARIEMGSGSYALRAQLNNKDAVGIGIFQSPGA
NAIDLSDAVRAKMDELATRFPEGMTWRAPYDPTVFVRDSISAVVHTLLEAVVLVVLVVIL
FLQTWRASIIPLLAVPISVIGTFSILYLLGFSLNTLSLFGLVLAIGIVVDDAIVVVENVE
RNIEEGLAPRDAAHQAMREVSGPIVAIALVLCAVFVPMAFLSGVTGQFYKQFAVTIAIST
VISAINSLTLSPALAALLLKSHGAPKDMPSRLIDRLFGWIFRPFNRFFNASSHRYQNAVS
KTLGRRGAVFVVYILLLCAAAFMFKAVPGGFIPTQDKLYLIAGVKMPEGASLSRTDAVIR
KISAMGLSTDGVIDAVAFPGLNALQFTNTPNTGTVFFALKPLSERTRTAAEINAEINAKI
SQIQEGFAFSIMPPPILGLGQGSGYSLYIQDRAGLGYGALQTAINTMSGAIMQTPGMGYP
ISSYQANVPQLDAHIDRDKAKAQGVSLDELFSTLQVYLGSSYINDFNRFGRTWKVMAQAD
GQFRDTVEDIANLRTRNDKGEMVPIGSMLNITTTYGPDPVIRYNGYPAADLIGDADPRVL
SSTQAMTELTAMSKNLLPNGMNIEWTDLSYQQSTQGNAALIVFPMSVLLAFLVLAALYES
WTLPLAVILIVPMTMLSALFGVWLTGGDNNVFVQVGLVVLMGLACKNAILIVEFARELEL
QGKGIIESALEACRLRLRPIVMTSIAFIAGTIPLILGHGAGAEVRGVTGITVFSGMLGVT
LFGLFLTPVFYVALRKLVTRKKVVLETQTV
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggacttttcccgctttttcatcgacaggccgatttttgcggccgtcttgtcgattctg
attttagtcaccggggcgattgccattcccctgctgccggtcagcgaatacccgaacgtg
gtaccgccaagcgtgcaggttcgcgctgaatatccgggtgctaacccgaaagtgattgct
gaaaccgtggcgacgccgctggaagaagcgatcaacggtgttgaaaacatggtgtacatg
aaatccgtggccggttctgatggtgtgctggtgacgacagtcactttccgtccgggaacc
gatccggatcaggcacaggttcaggtgcaaaaccgtgtggcccaggccgaagcccgtctg
ccggaagatgtccgccgtcagggcgtgaccacgcagaaacaatcgccaacgttgacgctg
gtggtgcatctggtgtcaccttcgggtaaatatgattcgctgtatctgagcaactacgcc
acgctgaaggtgaaagacgagctggcacgtttgccgggtgtcgggcagatccagattttc
ggtgcaggcgaatatgccatgcgcgtgtggctggatccgaacaaagtcgcggcgcggggt
ctgacggcttctgacattgtgaaggcaatgcaggaacagaacgtacaggtgtctgccggt
cagctgggcgcagaaccgatgccgaaagacagtgattatctgctttccatcaatgcgcag
ggtcgtctgaaagatgaagatgagttcggcaaaatcatcctgaaaagcggtgataatggc
gaaattgtccgtcttcgtgatgtggcgcgtatcgaaatggggtccggcagttatgccctg
cgcgcgcaacttaataataaagatgcagtcgggatcggtatcttccagtcgcctggcgcg
aatgcgatcgatttgtcagacgcggtgcgagccaaaatggatgaactggcaacccggttc
ccggaaggcatgacctggcgtgcgccgtacgacccgacggtgtttgtccgtgattccatc
agtgcggtggttcacacattgctggaagccgtcgtgctggtcgtactggtggttattctg
ttcctgcaaacctggcgcgcgtcgatcattcctttgctggcggtaccgatatctgtgatc
gggacattcagcattctgtatttgctcggattttcgcttaatacactcagtctgttcggg
ctggtgctggcgatagggatagtggtcgatgatgccattgtggtggtggaaaacgtcgag
cgaaacatcgaggagggactcgcgccaagggacgctgcgcaccaggcgatgcgggaagtt
tcagggccgatagtggctatcgcgctggtgctgtgtgcggtgttcgtgccgatggcgttt
ttgtcgggcgtgaccggtcagttctacaagcagtttgcggtgaccatcgccatttcaacc
gtgatctcggccatcaactcactgacgttgtcccctgctcttgcggcattgctgcttaaa
tcgcacggtgcaccgaaagacatgccgtcgcggcttatcgaccgcctgttcggctggatt
ttccgaccgttcaaccggttctttaatgccagttcacaccgttatcagaatgcagtgtct
aaaacacttgggcgtcgtggcgcggtatttgtggtttacattctgctgttgtgtgcggcg
gcctttatgttcaaagccgtgccggggggctttatcccgacgcaggataaactgtatctg
atcgcgggcgtgaaaatgccggaaggcgcgtccttatcccgcactgatgcggtgatccgc
aaaatcagcgcaatggggttaagtactgatggcgtaattgatgcggtggcgttccccggg
ttgaacgctttgcagttcaccaatacgccgaataccggtacggtgttcttcgcgttgaaa
ccactgagcgaacgtacccgtacagcggcggagattaatgcggaaatcaacgccaagatt
tcgcagatccaggaagggttcgccttctccattatgccgccgccgatcctcggattgggt
cagggatcaggttattctctgtatatacaggatcgtgcagggctgggttacggtgcattg
caaaccgcgattaacaccatgtccggcgctatcatgcaaacgccgggaatggggtatccg
atttcttcatatcaggctaacgtgccgcagttggacgcgcatattgaccgtgataaagcc
aaggcgcagggcgtatcgctggacgaactgttcagtacgctgcaggtgtatctcggctcg
tcctatatcaatgatttcaaccggttcggacgtacctggaaagtaatggcacaggccgat
ggccagttccgtgacaccgtggaagacattgccaatctgcgtacccgtaacgataaaggt
gaaatggtgccaatcggcagtatgctgaatatcaccaccacttacggtcccgatccggtg
atccgctataacggctatccggcagcagatttaatcggtgacgctgatccccgcgtgctt
tcttcgacgcaggcaatgaccgagctgactgcaatgtcgaaaaacctgttaccgaacggc
atgaatatcgaatggaccgacctgagctatcagcaatccacacaaggcaatgctgcactg
attgtgttcccgatgtccgtgttactggcgtttctggtgctggccgccctgtatgagagc
tggacgctgccgctggcggtaatcctgattgtgccaatgaccatgctatcggccctgttt
ggcgtgtggctgaccggtggcgacaataacgtgtttgtacaggtcggactggtggtgctg
atgggactggcatgtaagaacgcgattctgattgttgagttcgcccgcgagcttgaactg
caaggtaaagggattatcgaatctgcgcttgaggcatgccgtctgcgtctgcgccctatc
gtcatgacctcgattgcgtttatcgccgggactatcccgttgattctggggcacggcgcg
ggtgcggaagtgcgcggtgtcaccggtattaccgtattctccggtatgctgggtgtgacg
ttgttcgggttgttcctgacgcctgttttctacgtcgcacttcgcaagctggtgacgcgt
aagaaagtcgttttagaaacgcaaactgtgtaa

DBGET integrated database retrieval system