KEGG   Rahnella aquatilis HX2: Q7S_23026Help
Entry
Q7S_23026         CDS       T01850                                 

Definition
(GenBank) outer membrane pore protein N, non-specific
  KO
K14062  outer membrane protein N
Organism
raa  Rahnella aquatilis HX2
Brite
Transporters [BR:raa02000]
 Other Transporters
  Pores ion channels [TC:1]
   Q7S_23026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_1 OMP_b-brl
Motif
Other DBs
NCBI-ProteinID: AFE60767
UniProt: H8NZS7
Position
PRA1:complement(64871..65473)
Genome map
AA seq 200 aa AA seqDB search
MRGGVYLRNQTENQVNNHIKHIVNGHFTSYDFGMGITVGAAYASSDRTNDQTTSAGENFA
GGDKADVWTVGTKYDANNVYLATMYSETRNMTMFGESGVANKTQNFEVTAQYQFDFGLRP
EVSYLQSKGKDLTADGSNTSDNNDKDLVKYVSVGASYYFNKNMSTYVDYKINLLDNDDNF
YETNKISTDDIVGVGLQYQF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggtggggtttatttacgtaatcaaactgaaaatcaagttaataatcatattaaa
catatagttaatggacatttcacttcctacgacttcggtatgggtatcactgtgggtgcc
gcgtatgcatcatctgaccgtacaaacgatcagacgacttctgcaggtgagaattttgca
ggaggggataaagctgatgtctggactgtgggtacaaaatatgacgcaaacaatgtctat
ctcgctacgatgtattccgaaacgcgtaatatgacaatgtttggtgagagtggtgttgca
aacaaaacgcagaacttcgaagtaaccgcacaatatcagtttgattttggattacgtcct
gaagtgtcttacctgcaatctaaaggtaaggatttgactgcagacggcagtaatacttct
gataacaacgataaagatttggttaaatatgtttctgttggtgcgagttattacttcaac
aaaaatatgtccacctacgttgattacaaaattaacctgctggacaacgatgataatttc
tacgaaaccaacaaaatctctaccgatgatatcgtgggtgtaggcttacaatatcagttc
taa

DBGET integrated database retrieval system