KEGG   Rahnella aquatilis HX2: Q7S_23041Help
Entry
Q7S_23041         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFE60770
UniProt: H8NZT0
Position
PRA1:complement(67743..67904)
Genome map
AA seq 53 aa AA seqDB search
MIGECYLMLAEDEGGVSRRRMVIWLERVQEEVVDSNSKQNDALQLAIQRLKGW
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atgattggtgagtgttaccttatgcttgcggaagatgaggggggagtcagccggaggcgc
atggttatatggctggagcgagtccaggaagaagttgttgattcgaacagtaaacaaaat
gatgccttacagttagcgatacaacgtctaaagggctggtag

DBGET integrated database retrieval system