KEGG   Rahnella aquatilis HX2: Q7S_23046Help
Entry
Q7S_23046         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nup54 GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFE60771
UniProt: H8NZT1
Position
PRA1:complement(68294..68575)
Genome map
AA seq 93 aa AA seqDB search
MEALLCIREIAETRISYGCPRINPQLYIDEEGELFAKEDTLLLNTLGVSAAYSGAVIKAL
KKRNEDQAELISALSERLKQIESTLGINNKPAS
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
gtggaagcattactgtgcatcagagaaattgcggaaacacgaataagctacggctgccca
cgcattaatccgcagctttatatcgacgaggaaggtgagctcttcgcgaaagaggacacg
ctattgctcaacacactaggggtatcagccgcatattctggtgccgttattaaagcatta
aagaaacgcaatgaagaccaggcagaacttatctcagcgttatccgaacggctaaaacag
atcgagtcaacgcttgggattaacaacaaacctgcttcataa

DBGET integrated database retrieval system