KEGG   Rahnella aquatilis HX2: Q7S_23056Help
Entry
Q7S_23056         CDS       T01850                                 

Definition
(GenBank) acyltransferase
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 TMEM215
Motif
Other DBs
NCBI-ProteinID: AFE60773
UniProt: H8NZT3
Position
PRA1:70167..71171
Genome map
AA seq 334 aa AA seqDB search
MREQWVDYAKGIGIILVVIGHVNRGLDSAGISISEPFFKIFDSIIYTFHMPLFFFLSGLF
FIRSIQKNGKPEFIKKKVATIVYPYVIWSVIQGSIAVLLSNLTNKKTDFISVLSFPYQPI
GQFWFLYALFMIFIVACLIYNKRSFITQLPIITALSFLLYIYSLNVGYSFHLNFITNNIV
FFFSGCFFSTLKLDQMVTKTNAATLLISVFLFLLVQYKFHFIDGMIYDRVGISTFVVAMV
SIFLIYVLSLTLSSIKVDLLSKIGNVSMVIFLVHILCASGTRIILSKVLGVSNWHLHMIA
GTIAGVVIPIIFYDLVKKLNLEFLFTYPVKSKNS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagagaacagtgggtagattatgctaaaggcatagggataatattggttgtcattggg
cacgttaatagaggtttggatagcgctggtatatctatatcagaacctttttttaaaatt
ttcgatagcatcatttacacctttcatatgcctttgtttttctttctttcaggacttttc
tttataagatctatacaaaaaaatggtaagcccgaattcattaagaagaaggtagctact
atagtatacccttatgtcatatggtcagtcattcagggatctatcgctgtattgctttca
aaccttacaaataaaaaaacagatttcatttctgttctttcttttccatatcagccaatc
ggtcagttctggtttctctatgctttgtttatgatttttatagtggcatgtttaatatat
aacaaaagaagcttcataactcaattgccaataataaccgcattgtcatttttattatat
atttatagtttaaatgttggatattcatttcacttaaatttcataacaaataatattgta
tttttcttttcaggatgtttttttagtactttgaaattagaccaaatggttacaaaaaca
aacgcagcgactttgcttatatcagtcttcttgttccttcttgttcaatataaatttcat
ttcattgatggcatgatctatgacagagtaggtatttcaacattcgttgttgctatggtt
tcaatattcttaatttatgttttatctctgactctcagctcaataaaggttgatttacta
agtaagataggaaatgttagtatggttattttccttgtgcacatactctgtgcaagtggc
acaaggataattctaagtaaagtattaggggttagcaactggcacttacacatgattgct
gggactattgcaggagtagtgatccctataatattttatgatttagtaaaaaaactgaac
ttggaattcctttttacttatccagtaaaaagtaaaaactcttag

DBGET integrated database retrieval system