KEGG   Rahnella aquatilis HX2: Q7S_23066Help
Entry
Q7S_23066         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1899
Motif
Other DBs
NCBI-ProteinID: AFE60775
UniProt: H8NZT5
Position
PRA1:complement(72229..72465)
Genome map
AA seq 78 aa AA seqDB search
MALSKYSATRTVQAMKIESIQVNPDFSAILTDSDGTTIIVSQEYVLREKPSAGGYYMKDS
DGFESYIIRDIFEDNFSA
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggcattatcaaaatatagcgccacacgaactgtgcaagccatgaagatagaatcaatt
caagttaatcctgatttttcagctattttaactgattctgatggaacaaccattattgtt
tcacaggaatatgtattaagagagaagccaagcgcaggagggtattacatgaaggactct
gatgggtttgaaagttatataattcgcgatattttcgaagataatttttcggcatga

DBGET integrated database retrieval system