KEGG   Rahnella aquatilis HX2: Q7S_23076Help
Entry
Q7S_23076         CDS       T01850                                 

Definition
(GenBank) putative kinase
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage-tail_3
Motif
Other DBs
NCBI-ProteinID: AFE60777
UniProt: H8NZT7
Position
PRA1:complement(74664..77735)
Genome map
AA seq 1023 aa AA seqDB search
MTIKIYPSRLPGEPLETHHHKAMTLHHWFARNVKEYTQAKIPPFVVEIAGRNVPPAEWEV
CELTPDSDVCIYPVPYGTGLEFAAWAAIAVAVASAAYSIFMMSSLDAGSYTSSTGKSLDL
NPAEANSAKLGNAIREVFGRTRVYPDYVVSPVTRFDATDPTIMRVSMLICVGMGNFAFTD
GDIRVGNTPASSLTGFDYTVYPPGTDVSNDDRSENWFSSTEVGGTSSGSGLDMAQTAPKA
DDIISDSMTVSGASVSFTGLDTNDDDDADGDDEALPDSWGEGGVVEIIAPTTFNVSSSSG
YSVLSSDFLSEINPHVGMPVTMTYGSIDYQLCIASYTPSQEAVPGVGGSAASIQASAAPT
TYDFSTSTATFDVIWHGTTYTISLIADYVTMSGLVAAITEALGGSGLTAQNNSGRVLIAE
PSSPYAGGSIMASSLPSSVFGSSPVNTSGATSSGGSAAVTASVTLAYDSATGTAFTGVPT
GQQRLSVSHRGYEYQIVSVSGATTIVQRLIDGMVDATWPGFSSRTMIDYEASGINDNDTW
MGPFFACPENEICDTIEVNFSFPSGICGFNSKGKKQNRTVEWEIQYRVYGSGSGWLSHTG
KYSLKNINGLGFTERITPQEPGLIEVRCRRLNEQGSSNARDSMFWQALRGRLLSRPSSYE
GVTLMGVTVESGGKLAAQSDRRVNVVVTRQYVTGTARTISGALLHVGTSLGLDMDEDTIA
ALEIVHWTPNGDCFDYSADSSSSDSSSALDVLQKITNAGKSYFLLNDGLASVGLEGVKTW
TGIISPQETTEHLETSFSAPSDDDYGGVDVTYINGITWAEETVQCRLPGNPTPSKVEAYS
LDGVHDGSKAYQIGMRRLMKYLKQRLTHTATTELDTLCYNVGDRIILTDDIPGNKTVSCL
ILAMRTTNGMTTFSVSELLDWTFNNPRAVIRFQDGTASSLLVATEVGDYEISVPHQSVFD
EIVLSNPSIEPPRLIFCDSSRVGYDALITEISPQSSGTCQVTAKEYSASFYNYDNATYPG
DVA
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgactataaaaatttatccatcccgcctgccaggggaaccgcttgaaactcatcatcat
aaggccatgacgttacaccattggtttgcccggaacgtgaaggaatacacgcaggccaaa
atcccgccttttgtcgtcgagatagcaggccgtaatgtgccccctgcggaatgggaagtt
tgcgagttgacacctgattctgatgtatgcatttacccagtcccatatgggactgggttg
gagttcgcagcctgggcagcgattgctgttgctgtggcgtctgccgcttattctattttt
atgatgtccagcctggatgccgggtcatatacgtcatcaaccgggaaaagtttggacctg
aatcccgctgaggccaactccgcaaagctgggcaatgctatacgcgaggttttcggtcgc
acccgtgtttatccggattatgtggtttccccggttacccgttttgatgctaccgaccct
acaatcatgcgcgtcagtatgctcatctgcgtcggtatgggtaattttgcttttaccgat
ggtgatatcagagttggcaacacacccgcatcatcacttacaggcttcgattatacggtg
tatccgcctggtactgacgtgtccaatgatgatcgcagtgaaaactggttttcttcaacc
gaggttggtggaacatcatcaggatccggtcttgatatggcacaaactgcgccgaaagcg
gatgacattatttctgacagcatgacggtttccggtgccagcgtttcattcaccggcctc
gacaccaatgacgacgatgatgcggacggtgacgatgaagcgctgccagactcatggggc
gagggtggggtcgttgagattattgcaccgacaacctttaacgttagctcatcatctggc
tacagcgtactgtcaagtgatttcctctctgaaataaatccgcatgttggtatgccggta
accatgacttacggcagcatcgattatcaactgtgcattgcaagttatacgccatcacag
gaggcagtaccgggcgttggcgggagtgcggcatccattcaggccagcgcagcaccgaca
acttatgatttttcaaccagtacagccacgtttgatgtgatctggcatggtaccacttac
actatatctctgattgctgactacgttacgatgtccggcctggttgcggccatcaccgag
gcgctgggaggttctggtcttaccgcgcagaataatagcggcagggtgttgattgcggag
ccatcaagcccctacgctggcggtagtattatggcatcctctttgccatcaagtgtgttc
ggttcatctccggttaatacatcgggcgcaacgtcatccggtggcagcgccgccgtaacg
gcaagcgtcacgctggcctacgatagcgcaacaggtacagcatttacgggggtcccaaca
ggccagcagcgcctgtctgtatcccatcgtgggtatgagtaccagattgtgtctgtatcc
ggtgcaacaacgatagtacaacgcctaatagatgggatggttgacgcgacatggccaggt
ttttcatccaggacaatgatcgactatgaagccagtggcatcaatgataacgatacctgg
atgggtccattctttgcctgtccggaaaatgaaatctgtgacacgatcgaggttaatttt
tccttcccgagtggtatatgcggctttaacagcaaaggaaagaagcagaatcgcactgtt
gaatgggaaatccagtatcgcgtatacggttcaggcagtggatggcttagccacaccggg
aagtatagcctaaagaatatcaacgggttgggattcacagagcggattacccctcaggaa
cctgggttgatcgaggttcgttgccgcagactgaatgaacaggggagtagcaatgctcgt
gactcaatgttttggcaggctttgcgcgggagactgctaagcagaccgtcatcctatgag
ggagtgactctgatgggtgtcactgttgagtcgggaggtaagctggccgcacagtcagac
cgcagggttaatgttgtagtaacgcgtcaatacgtcactggcactgctaggactatatcg
ggtgcacttctacatgttggtacttcgctgggtctggatatggacgaggacaccattgca
gcactggaaattgtccactggacaccgaatggagattgcttcgattactccgcagattca
tcctcatcagattcatcgtctgccctcgacgtgctccagaaaattaccaatgccggtaaa
agttacttcctgttaaatgatggcctggcatcggtggggctggaaggcgtgaaaacatgg
acggggattatcagtccgcaggaaactacagaacatctggaaacgtcattctctgcgccg
tcagacgatgactatggcggggtcgatgtcacatacatcaatgggattacctgggcagag
gaaactgtacagtgcaggttgccaggcaatcccactccgtcaaaagtagaggcgtattct
cttgatggtgttcatgatgggagcaaagcctatcagatcggtatgcgccgcctgatgaaa
tatctgaagcaacgtttgacgcatacagctaccactgagcttgatacgctctgctataac
gtcggcgatcgcataattctgactgacgacataccgggtaataaaacggtttcgtgcctt
attctggcgatgaggactacgaatggcatgacgactttcagtgtaagcgagttgcttgac
tggacgtttaataacccccgcgcagttatccgatttcaggatggcaccgcatcatcgctc
ttggttgctactgaggtgggtgattacgagatttctgttccgcatcagtctgtattcgat
gagattgtgctaagtaatccatcaatagagccaccacggctgatattttgtgactcatcg
cgagttggatacgacgcgctgataactgagatctccccacagagcagcggaacatgccag
gttaccgccaaagagtacagcgcatcattctacaattatgacaatgccacatatcccggc
gatgtcgcttaa

DBGET integrated database retrieval system