KEGG   Rahnella aquatilis HX2: Q7S_23091Help
Entry
Q7S_23091         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFE60780
UniProt: H8NZU0
Position
PRA1:complement(78601..79065)
Genome map
AA seq 154 aa AA seqDB search
MVDIYYPHDYLPLPLQDGLAYKPVSPLLRTSLTSGRARQRRLYISVPTQAAVKWLFKKHS
QAQLFEVWYRDKIADGAAWFYMKLKTPLGVEQYKCRFTDIYEGPALLAGKFWQFTATLEL
WERPILPPEWGDFPDFIINSNIIDLAMNREWPEA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtagatatttattatccgcatgattatctgccactccctttacaggatggtctggca
tataaaccggtaagcccattgcttcgcacatccttgacttccgggagggcgcgacaacgc
aggttgtacatttctgtgccaacgcaggcagcggtaaaatggctattcaaaaaacactcg
caggcgcagctttttgaagtctggtatcgggacaagattgccgatggcgctgcctggttt
tatatgaaactcaaaacaccgctcggtgttgaacagtacaaatgcagatttacagatatt
tatgagggcccggcattgttagcggggaaattctggcagttcacagcaacgcttgaatta
tgggagaggccaatccttccgcctgaatggggggatttccccgacttcattatcaacagc
aatattatcgatttggcgatgaaccgggagtggccagaagcatga

DBGET integrated database retrieval system