KEGG   Rahnella aquatilis HX2: Q7S_23161Help
Entry
Q7S_23161         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lum_binding
Motif
Other DBs
NCBI-ProteinID: AFE60790
UniProt: H8NZV0
Position
PRA1:complement(88287..88505)
Genome map
AA seq 72 aa AA seqDB search
MNQADIEDMIQQYMTAERAVLLGKSITFNGQSMTMENLSEIQKGRKAWERRLSTLLAAQR
GRPQYRLARFPR
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggccgatattgaagacatgatccagcagtatatgaccgctgaacgcgccgtt
ctgctggggaaatccatcacctttaacgggcagtccatgacgatggagaacctcagtgaa
attcagaaggggcggaaagcctgggagcgccggttaagcacgttgctggcggcgcagcgc
gggcgacctcagtaccggttggcgaggttcccgcgatga

DBGET integrated database retrieval system