KEGG   Rahnella aquatilis HX2: Q7S_23166Help
Entry
Q7S_23166         CDS       T01850                                 

Definition
(GenBank) terminase GpA
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terminase_GpA Cys_rich_CPXG Spc97_Spc98
Motif
Other DBs
NCBI-ProteinID: AFE60791
UniProt: H8NZV1
Position
PRA1:complement(88502..90616)
Genome map
AA seq 704 aa AA seqDB search
MKMLINGYASASALRRDVATLLKPPRRMPVAEAVSKFMRVPMGAGSSLPWDATLTPYIIE
PMNCLASRDYDAVVFVGPARTGKTIGLIDGWIVYAIVCDPADFLLIQMTEEKAREHSKKR
LDRTFRVSKEVASRMSPRTNDNNVHDKTFRAGNYLKIGWPSINIMSSSDYRFVALTDYDR
WPDDIDGEGDGFTLASKRTTTFMSSGMTLVESSPGREVTDTKWRRSSLHEAPPTTGILSL
YNRGDRRRWYWPCPHCGEYFQPSKDVVQGYQNIVDPVIASEAAFIECPHCRGKVTADQKR
ALNQKGVWLRDGEKIDRHSVITGTARRSRIASFWMEGPAAAYQTLSQLVYKLLSAQQDYE
ANGSEETLKAVINTDWGLPYIPQSSVEQRKSETLMARATVVTKRTVPDGVRFLVATVDVQ
GGRNRRFVVQVIGYGAHGERWIVDRYNIKQSMRTGQNGESLPVDPAGYLEDWNLLHTDVL
DKEWPLNSNPGVSLPVLAMAVDSGGEDGVTGNAYEFWRQCRRDGVHKRVYLFKGDSTTRS
KLITKSLPDNTDRPNRRAEARGDVPLYLLQTNMLKDRISNALQRDTPGANYVHFPDWLGE
WFYDELTYEERGADGKWTKPGKGANEAFDLMVYAHALVILRGYERINWEKPPGWALPVEQ
SAPLAPSDSPVPKPRSNHLKPKTTRARKEEKPSAWAPSTSGGWV
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgttaattaacggctatgcgtcagcaagtgcactgcgccgtgatgtggctaca
ttactgaagccaccaagacgaatgcccgtggcggaggcggtctccaagtttatgcgagtg
cccatgggagccgggagttccttaccgtgggatgcaacgctcacaccctacattatagag
ccgatgaattgtctcgcttctagggattatgacgcagtggtgtttgttggccccgcgcga
accggtaaaacgattggtcttattgatgggtggatagtgtatgccattgtctgtgatcca
gcagacttcctgttgatacagatgacggaagaaaaggcgagggagcattcaaaaaagagg
ctggatagaacctttcgcgtcagcaaggaggtggccagtcgcatgagtccgcgcacaaac
gataataacgtccacgataagaccttcagagcgggcaactaccttaaaatcggctggccc
tcgatcaacatcatgtcatcctctgactaccgatttgttgcactaactgattatgaccgt
tggccggatgatattgatggtgagggggacgggttcacgctggcctcaaaacgtactacg
acatttatgtcatccggtatgacgttggtggagagttcgccaggccgtgaagtcactgac
acaaaatggcggcggagttccctgcatgaggcgccccccacaacaggcattctttcttta
tataaccgaggcgaccgtcgccgttggtattggccgtgcccgcactgcggcgaatatttt
cagccatcgaaagatgtggtgcagggctatcagaatattgtcgatccggtgattgccagc
gaggcggcattcattgaatgcccacattgccgcggaaaagtcacagcagaccagaagcgc
gctcttaatcagaaaggtgtctggctgcgcgacggtgagaagattgaccgtcatagtgtg
attacgggtaccgcgagacgttcccgcattgcttctttctggatggaaggccccgcagcg
gcatatcaaaccctgtcccaactggtttataagctgctttctgcccagcaggattatgag
gccaacggcagtgaagaaaccctcaaagcggtgatcaacactgactgggggctgccttat
attccacagtccagcgtcgagcagcggaaatccgaaacgctcatggcgcgcgccaccgtg
gtgaccaagcgtacggtacccgacggcgtgcgttttctggtggcgaccgttgacgtacag
ggcgggcgcaaccggcgctttgtggtgcaggtgattggttatggcgcgcacggtgagcgg
tggattgtcgaccggtacaacatcaaacagtcgatgcgcacggggcagaacggcgaaagt
ctgccagttgaccccgcaggctatctggaagattggaacctgcttcacaccgacgtgctg
gataaggagtggccactcaacagcaacccgggtgtttccctgcccgtgctggcaatggcc
gtcgattccggcggtgaagacggggtgaccggtaatgcctatgagttctggcgacaatgt
cgccgcgatggcgttcacaagcgcgtttatctcttcaaaggcgacagcacgacccgaagc
aagctgatcaccaagtcactgccggacaatactgaccgtcctaaccggcgggcggaggcc
cgcggcgacgtgccgctctacctgctgcagaccaatatgctcaaagaccggatcagtaac
gcgcttcagcgcgatacgccgggggctaactacgttcactttcctgactggctgggggag
tggttctatgacgaactgacctatgaagaaaggggcgctgatggcaaatggacgaagcca
gggaaaggggcgaacgaagcctttgacctgatggtatacgcccatgcgttggtgattttg
cgagggtacgagcggataaactgggaaaaaccgcctggctgggcgctccccgttgaacag
tccgctccgcttgcaccttctgattcacccgtaccgaaaccccgcagtaatcatctaaaa
ccgaaaacaacccgcgccaggaaagaggaaaaaccctctgcctgggcgccatcgacatca
ggaggctgggtatga

DBGET integrated database retrieval system