KEGG   Rahnella aquatilis HX2: Q7S_23171Help
Entry
Q7S_23171         CDS       T01850                                 

Definition
(GenBank) hypothetical protein
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1441 HTH_23 Terminase_5 Sigma70_r4_2 Sigma70_r4 HTH_28 HTH_AsnC-type HTH_30 HTH_IclR HTH_8
Motif
Other DBs
NCBI-ProteinID: AFE60792
UniProt: H8NZV2
Position
PRA1:complement(90600..91109)
Genome map
AA seq 169 aa AA seqDB search
MSNISNLGDAYNWSVAKIAEAFGLNRGTVRKRLLDANTPIAGTVKGNPVYALKDVGPILF
GTNEPDDPDELQNPNKMGPKDRKDWYQSENERIKLEESLKQLLPASEAHREMALLVKAIS
QVLDTWPDKLERDRGWRPEQIAEAQTVIDEMREVLAEEVAAVEDGENVN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatatcagcaatctgggggacgcctacaactggagcgtagcgaagattgctgag
gcttttgggttgaaccgtggaacggtaagaaagcggctgctcgatgctaatacaccaatc
gccggcacggtgaaaggcaaccctgtttacgcccttaaagacgtggggccaattctcttc
ggcacgaatgaacctgacgatcctgatgaacttcagaaccccaacaaaatggggccgaag
gatcgtaaggattggtaccagtctgaaaacgagcgcatcaagttagaggagtcgctcaaa
cagttgcttcccgcatctgaggcacaccgtgagatggcgttgttggtaaaggctatctct
caggtgctcgatacctggccggataaattggagcgcgaccgtggctggcgtccagaacaa
atagccgaagcgcagacagtcattgatgaaatgcgtgaagtgttggcagaagaagttgcg
gcagttgaggacggtgaaaatgttaattaa

DBGET integrated database retrieval system